OwlCyberSecurity - MANAGER
Edit File: 1657127323.M565365P4021828.server237.web-hosting.com,S=116894,W=120217:2,
Return-Path: <bounce-spmcvjjpbktmjlmptbkmsbrvrjjtzsvwpbrk@communication.hanleywood.com> Delivered-To: elvis@ebaarchitects.org Received: from server237.web-hosting.com by server237.web-hosting.com with LMTP id mKnjIJvBxWJEXj0A7Ypugw (envelope-from <bounce-spmcvjjpbktmjlmptbkmsbrvrjjtzsvwpbrk@communication.hanleywood.com>) for <elvis@ebaarchitects.org>; Wed, 06 Jul 2022 13:08:43 -0400 Return-path: <bounce-spmcvjjpbktmjlmptbkmsbrvrjjtzsvwpbrk@communication.hanleywood.com> Envelope-to: elvis@ebaarchitects.org Delivery-date: Wed, 06 Jul 2022 13:08:43 -0400 Received: from mail4.communication.hanleywood.com ([96.46.128.145]:52542) by server237.web-hosting.com with esmtps (TLS1.2) tls TLS_ECDHE_RSA_WITH_AES_256_GCM_SHA384 (Exim 4.95) (envelope-from <bounce-spmcvjjpbktmjlmptbkmsbrvrjjtzsvwpbrk@communication.hanleywood.com>) id 1o98Vx-00Gus4-Uc for elvis@ebaarchitects.org; Wed, 06 Jul 2022 13:08:43 -0400 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; s=class; d=e.hw-commercialdesign.com; h=Date:From:Reply-To:To:Message-ID:Subject:MIME-Version:Content-Type: Content-Transfer-Encoding:List-Unsubscribe; i=architectnewswire@e.hw-commercialdesign.com; bh=mC/ehmWRIc3geOzwYmA0h6wJ67vnrEu3/9w474WRxO8=; b=j022qz6wDnBhp2NZduhwctIVPZAZvGaE/i75CG0cGstv0RVidf+q3JPduUgJrGOhidiJY0y0SEST owtnJVyb1Pxzot5eiO85K5/eeu3olGOWuIkdQ9aDCNvRt69oUMy75p2kcbDz07SWLoZFA1/NYdX/ N6UjRZ45r11cwFzDV+4= DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; s=class; d=communication.hanleywood.com; h=Date:From:Reply-To:To:Message-ID:Subject:MIME-Version:Content-Type: Content-Transfer-Encoding:List-Unsubscribe; bh=mC/ehmWRIc3geOzwYmA0h6wJ67vnrEu3/9w474WRxO8=; b=aqudFF91B9eIRIb3/KYM2U9U8PQs+YOEG2SAE1lpn/N6dbzMnPkn3dQx/Za8t3NYIN6F6w/FdPrl m6FKPJY4N5aP6T1JJlQZppWjgVAIUE/ADlKd7NXajTLVdsSEaIQQpoeFa6+ez/rHNxy5vk0jD5oy YLiXqIRO/NIo9OSg1Fs= Received: by mail4.communication.hanleywood.com id hon0mq2uaicq for <elvis@ebaarchitects.org>; Wed, 6 Jul 2022 12:07:56 -0500 (envelope-from <bounce-spmcvjjpbktmjlmptbkmsbrvrjjtzsvwpbrk@communication.hanleywood.com>) Date: Wed, 6 Jul 2022 12:07:56 -0500 (CDT) From: Architect Newswire <architectnewswire@e.hw-commercialdesign.com> Reply-To: Hanley Wood <updates@communication.hanleywood.com> To: friend <elvis@ebaarchitects.org> Message-ID: <1080158916.13969510.1657127276996@communication.hanleywood.com> Subject: Meet the Winners of the 2022 AIA Election MIME-Version: 1.0 Content-Type: text/html; charset=UTF-8 Content-Transfer-Encoding: quoted-printable X-HANW: ycvlvbgfcfllnslsnqqsqvklgm pbqyvslgcgfqfrgqyggyglcfpwskstwbnfqmmvsgnkmckvnsgkbslqlmm glvmfqgcl List-Unsubscribe: <mailto:unsub-4300916-50859-A73B912686434D63B66B6284AE151CE7@communication.hanleywood.com> X-Spam-Status: No, score=0.4 X-Spam-Score: 4 X-Spam-Bar: / X-Ham-Report: Spam detection software, running on the system "server237.web-hosting.com", has NOT identified this incoming email as spam. The original message has been attached to this so you can view it or label similar future email. If you have any questions, see root\@localhost for details. Content preview: Architect Newswire 2022 AIA Associates Award: Julian T. Owens, Emily McGee, Jennifer Peeler Truman 2022 AIA Awards Content analysis details: (0.4 points, 5.0 required) pts rule name description ---- ---------------------- -------------------------------------------------- 0.0 URIBL_BLOCKED ADMINISTRATOR NOTICE: The query to URIBL was blocked. See http://wiki.apache.org/spamassassin/DnsBlocklists#dnsbl-block for more information. [URIs: hw-commercialdesign.com] 0.2 HEADER_FROM_DIFFERENT_DOMAINS From and EnvelopeFrom 2nd level mail domains are different -0.0 SPF_PASS SPF: sender matches SPF record 0.1 URI_HEX URI: URI hostname has long hexadecimal sequence 0.0 HTML_IMAGE_RATIO_04 BODY: HTML has a low ratio of text to image area 0.0 HTML_MESSAGE BODY: HTML included in message 0.1 MIME_HTML_ONLY BODY: Message only has text/html MIME parts -0.1 DKIM_VALID Message has at least one valid DKIM or DK signature -0.1 DKIM_VALID_AU Message has a valid DKIM or DK signature from author's domain 0.1 DKIM_SIGNED Message has a DKIM or DK signature, not necessarily valid -0.0 T_SCC_BODY_TEXT_LINE No description available. 0.0 T_KAM_HTML_FONT_INVALID Test for Invalidly Named or Formatted Colors in HTML X-Spam-Flag: NO =20 <!DOCTYPE html PUBLIC "-//W3C//DTD XHTML 1.0 Strict//EN" "http://www.w3= =2Eorg/TR/xhtml1/DTD/xhtml1-strict.dtd"> <html xmlns=3D"http://www.w3.org/1999/xhtml" xmlns:v=3D"urn:schemas-microsoft-com:vml" xmlns:o=3D"urn:schemas-microsoft-com:office:office"> <head profile=3D"http://www.w3.org/2005/10/profile"> <title>Architect Newswire</title> <meta http-equiv=3D"content-type" content=3D"charset=3Dutf-8"/> <meta http-equiv=3D"content-language" content=3D"en-us"/> <meta name=3D"viewport" content=3D"width=3Ddevice-width, initial-scale= =3D1.0, maximum-scale=3D2.0, user-scalable=3Dyes"/> <style type=3D"text/css"> /* Forces Outlook.com to display emails at full width */ .ExternalClass, .ExternalClass p, .ExternalClass span, .ExternalClass= font, .ExternalClass td, .ExternalClass div { line-height: 100%; } .ReadMsgBody { width: 100%; } .ExternalClass { width: 100%; line-height: 100%; } .ExternalClass p { margin-bottom: 0 !important; } /* Override AOL defaults */ body {font-family:Helvetica, Arial, sans-serif;font-size:12pt;margin:= 0;} th {font-size:12pt;} td {color: #6c6c6c;} td.eyebrow p a= [href]= { color: #ed1f24 !important; } /*Yahoo adds span.yshortcuts inside all links*/ a:link, span.yshortcuts { color: #000; /* Link color must be set inline for Gmail*/ background-color: none; border: none; text-decoration: none; } /* Overrides Outlook.com Contextual Highlighting */ span { color: #6c6c6c; border-bottom-width: 0; border-bottom-style: none; } p a:link, p span.yshortcuts { text-decoration: underline; } p a:active, p a:visited, p span.yshortcuts:active { text-decoration: underline; } a:active, a:visited, span.yshortcuts:active { color: #000; background-color: none; border: none; text-decoration: none; } a:hover, span.yshortcuts:hover, span.yshortcuts:focus { text-decoration: underline; } a.special-link, span.special-link { color: #f01e27 !important; text-decoration: none !important; } a.moreLink, span.moreLink, p a= [href]= { color: #00aeed !important; text-decoration: none !important; } h1 { color: #00aeed !important; text-decoration: none !important; } h1, h2, h3, h4, h5, h6, p, span { font-family: Arial, Helvetica, sans-serif; } h2, h4, h5 { color: #000 !important; /* Override Hotmail and Yahoo head tag colo= rs - Must also be set inline */ } h3 { color: #fff !important; } h6 { color: #777 !important; } .quote { color: #00adef !important; } p { margin-bottom: 0 !important; } .footertext { color: #777 !important; } table { border-collapse: collapse; } .MsoNormal { padding-bottom: 0 } /* =3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D= =3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D= =3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D= =3D=3D Mobile =3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D= =3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D= =3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D= =3D=3D */ table= [class=3D"mobileWrapper"]= { width: 650px !important; } table= [class=3D"mobileContent"]= { width: 615px !important; background-color: #ffffff !important; } table= [class=3D"mobileContent"]= td= [class=3D"50-50"]= > table { /*width: 300px !important;*/ max-width: 100% !important; } /*table= [class=3D"mobileContent"]= td= [class=3D"50-50"]= table= [align=3D"left"]= td{ padding-right: 12px !important; }*/ table.mobileContent td.mobileLogo { display: block !important; } table.mobileContent tr.mobileMobileLogo { display: none !important; text-align: left; } table.mobileContent td.mobileSocial img { margin: 0 !important; } table.mobileContent td.mobileSocial td { display: inline-block !important; width: auto !important; } table.mobileContent td.mobileAdwrapper img { border-style: none !important; } table.mobileContent td.extra-padding { padding-top: 5px !important; padding-bottom: 5px !important; } table.mobileContent td.extra-padding-bottom{ padding-bottom:18px !important; } @media only screen and (max-width: 614px) { table= [class=3D"mobileWrapper"]= { display: block !important; width: 350px !important; height: auto !important; padding: 0 15px !important } table= [class=3D"mobileContent"]= , table= [class=3D"mobileContent"]= table, table= [class=3D"mobileContent"]= thead, table= [class=3D"mobileContent"]= tbody, table= [class=3D"mobileContent"]= tfoot, table= [class=3D"mobileContent"]= th, table= [class=3D"mobileContent"]= td, table= [class=3D"mobileContent"]= tr, table= [class=3D"mobileContent"]= div.mobileThumbnail { display: block !important; width: 100% !important; height: auto !important; } table= [class=3D"mobileContent"]= td= [class=3D"50-50"]= > table{ width: 100% !important; float: none !important; clear: both !important; margin: 0 auto !important; } table= [class=3D"mobileContent"]= table= [class=3D"img-spacer"]= { display: none !important; } table= [class=3D"mobileContent"]= td= [class=3D"50-50"]= > table= [class=3D"spacer"]= { width: 100% !important; height: 10px !important; } table= [class=3D"mobileContent"]= td= [class=3D"50-50"]= > table td= [class=3D"mobileAdwrapper"]= { text-align: center !important; } table= [class=3D"mobileContent"]= td= [class=3D"50-50"]= table= [align=3D"left"]= td{ padding-right: 0 !important; } table= [class=3D"mobileContent"]= h3 { min-height: 12px !important; height: auto !important; width: 100% !important; } table= [class=3D"mobileContent"]= .mobileLogo { height: auto; } table= [class=3D"mobileContent"]= td.mobileAdwrapper { padding-left: 0 !important; text-align: center !important; } table= [class=3D"mobileContent"]= div.mobileThumbnail { display: block !important; width: 300px !important; max-height: 200px !important; height: auto !important; overflow: hidden !important; margin: 0 auto; } table= [class=3D"mobileContent"]= div.mobileThumbnail img { width: 300px !important; height: auto !important; } table= [class=3D"mobileContent"]= .mobileLogoImg { width: 300px !important; height: auto !important; } table= [class=3D"mobileContent"]= .mobileLeaderboardAd { padding-left: 0 !important; padding-right: 0 !important; } table= [class=3D"mobileContent"]= .mobileLeaderboardAd div { width: 100% !important; } table= [class=3D"mobileContent"]= .mobileLeaderboardAd img { width: 100% !important; height: auto !important; } table= [class=3D"mobileContent"]= .colSeparator { display: none; } table= [class=3D"mobileContent"]= .mobileDate { border-top: none !important; height: 35px; } table= [class=3D"mobileContent"]= .mobileSpecialLinks td { padding-top: 0 !important; padding-bottom: 20px !important; } table= [class=3D"mobileContent"]= .mobileSpecialLinks ul { font-size: 0; text-align: center; } table= [class=3D"mobileContent"]= .mobileSpecialLinks li { /*padding-right: 25px;*/ font-size: 15px; display: inline-block; } table= [class=3D"mobileContent"]= .mobileSpecialLinks li.mobileFirstChild { /*padding-right: 0px;*/ float: left; } table= [class=3D"mobileContent"]= .mobileSpecialLinks li.mobileLastChild { /*padding-right: 0px;*/ float: right; } table= [class=3D"mobileContent"]= .mobileSpecialLinks li.mobileArrow { background-image: url('http://images.hanleywood.com/newsletters= /arrow-right.png'); width: 14px; height: 14px; float: left; margin-right: 2px; } table= [class=3D"mobileContent"]= .mobileSpecialLinks li.mobileArrow img { display: none; } table= [class=3D"mobileContent"]= .mobileMagazine { float: left; width: 145px; padding-right: 10px; border-bottom: none !important; } table= [class=3D"mobileContent"]= .mobileMagazine div { border-bottom: none !important; } table= [class=3D"mobileContent"]= .mobileMagImg, table= [class=3D"mobileContent"]= .mobileMagImg img { width: 145px !important; height: auto !important; } table= [class=3D"mobileContent"]= .mobilePublicationLinks { float: left; width: 145px; } table= [class=3D"mobileContent"]= .mobilePublicationLinks + tr { clear: both; } table= [class=3D"mobileContent"]= .mobileColToRow { margin-bottom: 10px; } table= [class=3D"mobileContent"]= .mobileSocialIcons { width: 100% border-top: 2px solid #000; height: 34px; padding: 2px 0 !important; } table= [class=3D"mobileContent"]= td.mobileSocial { padding-bottom: 5px; } /* mobile hacks for the current issue before footer */ table= [class=3D"mobileContent"]= tr.mobileMobileLogo td > div { width: 100% !important; overflow: auto !important; height: auto !important; line-height: normal !important; } table= [class=3D"mobileContent"]= tr.mobileMobileLogo { display: block !important; } table= [class=3D"mobileContent"]= tr.mobileMobileLogo td > div { display: block !important; height: auto !important; width: auto !important; } table= [class=3D"mobileContent"]= .utilityLinks a.special-link span.special-link { font-size: 0.6em !important; } table= [class=3D"mobileContent"]= td.mobileSocial img { display: inline-block !important; } table= [class=3D"mobileContent"]= td.extra-padding { padding-top: 0px !important; padding-bottom: 0px !important; } table= [class=3D"mobileContent"]= .zero-height { height: 0px !important; } table= [class=3D"mobileContent"]= div.mobileImage { width: 300px !important; overflow: hidden !important; height: 200px !important; } table= [class=3D"mobileContent"]= div.mobileImage img { width: 300px !important; height: auto !important; } table= [class=3D"mobileContent"]= span#mobileChart { display: block; width: 300px !important; height: 200px !important; } table= [class=3D"mobileContent"]= .colSeparator { display: none; } table= [class=3D"mobileContent"]= .mobileLeftCol { display: inline-block; } table= [class=3D"mobileContent"]= .mobileRightCol { width: 80px !important; float: right; } table= [class=3D"mobileContent"]= .mobileLogo td { display: table-cell; } table= [class=3D"mobileContent"]= .mobileHeader img { max-width: 300px; height: auto; } table= [class=3D"mobileContent"]= .mobileHeader, table= [class=3D"mobileContent"]= .mobileHeader table, table= [class=3D"mobileContent"]= .mobileHeader td { height: auto !important; } table= [class=3D"mobileContent"]= .mobileHeader table { margin-top: 5px !important; margin-bottom: 5px !important; } table= [class=3D"mobileContent"]= .mobileHeaderAd, table= [class=3D"mobileContent"]= .mobileHeaderAd table, table= [class=3D"mobileContent"]= .mobileHeaderAd tbody, table= [class=3D"mobileContent"]= .mobileHeaderAd td, table= [class=3D"mobileContent"]= .mobileHeaderAd tr, table= [class=3D"mobileContent"]= .mobileHeaderAd h6 { width: 80px !important; } table= [class=3D"mobileContent"]= .mobileHeaderAd h6 { font-size: .55em !important; -webkit-text-size-adjust: none; -moz-text-size-adjust: none; -ms-text-size-adjust: none; } table= [class=3D"mobileContent"]= .mobileHeaderAd { ] border: none !important; position: absolute; top: -40px; } table= [class=3D"mobileContent"]= .mobileHeaderAd img { max-width: 80px; height: auto; } table= [class=3D"mobileContent"]= .mobileFooterAd img { width: 300px !important; height: auto !important; } td= [id=3D"mobileHideMagazineIssue"]= { display: none !important;=20 } table= [id=3D"mobileRelative"]= { position: relative !important; top: 50px !important; } } </style> </head> <body style=3D"background-color: #f2f3f5; color: #6c6c6c; font-size: 12pt;= margin-top: 0; margin-right: 0; margin-bottom: 0; margin-left: 0; padding-= top: 0; padding-right: 0; padding-bottom: 0; padding-left: 0;"> <table align=3D"center" width=3D"650" border=3D"0" cellspacing=3D"0" cellpa= dding=3D"0" class=3D"mobileWrapper" style=3D"width: 650px; margin-top: 0; margin-right: auto; margin-bot= tom: 0; margin-left: auto; padding: 0; font-family: Arial, Helvetica, sans-= serif; color: #6c6c6c; background-color: #fff;"> <tr> <td width=3D"615" style=3D"padding: 0; margin: 0; width: 615px;"> <table class=3D"mobileContent" id=3D"" width=3D"615" border=3D"= 0" cellspacing=3D"0" cellpadding=3D"0" align=3D"center" style=3D"margin-top: 0; margin-right: auto; margin-botto= m: 0; margin-left: auto; padding-top: 0; padding-bottom: 0;"> =20 <tr> <td style=3D"color: #6c6c6c !important;"> <p style=3D"margin-top: 0; margin-bottom: 20px !imp= ortant; font-size: 0.85em; color: #6c6c6c !important; "> <strong> <span style=3D"color:#6c6c6c !important;"> 2022 AIA Associates Award: Julian T. Owens,= Emily McGee, Jennifer Peeler Truman</span> </strong> </p> </td> </tr> <tr> <td align=3D"center" class=3D"mobileLeaderboardAd" width=3D"600" style=3D"padding-right: 6px; padding-top: 17px; padding-bottom: 3px= ; padding-left: 6px; text-align: center;"> <div style=3D"width: 600px; margin-right: auto; margin-left: auto;"= > <!--POWERINBOX 600x90--> <div class=3D"pi_17423 powerinbox"> <!-- domain: rs-stripe.architectmagazine.com --> <!--= [if (gte mso 9)|(IE)]= ><table align=3D"center" cellpadding=3D"0" cellspacing=3D"0" width=3D"600">= <tr><td><!= [endif]= --> <table width=3D"100%" border=3D"0" cellspacing=3D"0" cellpadding=3D"0"=20= style=3D"width: 100%; max-width: 600px;"> <tbody> <tr> <td width=3D"100%"> <a href=3D"http://click1.e.hw-commercialdesign.com/rtkhtnylcrvpwv= knpkfvnpyvvypvrwkhscgcbstcrncjvw_rgnknjjlcvpcvgtcrnrjj.html?a=3Delvis%40eba= architects.org&b=3D50859" style=3D"border-style: none; outline: none; text-= decoration: none;" target=3D"_blank" ref=3D"nofollow"><img alt=3D"" height= =3D"auto" src=3D"https://rs-stripe.architectmagazine.com/stripe/image?cs_em= ail=3Delvis@ebaarchitects.org&cs_sendid=3D50859&cs_esp=3Dpostup&cs_offset= =3D0&cs_stripeid=3D17423&dfp_nl_send_date=3D07/05/2022" style=3D"width: 100= %; max-width: 600px;display: block; border: 0; height: auto; line-height:= 100%; outline: none; text-decoration: none;" width=3D"600"></a> </td> </tr> </tbody> </table> <!--= [if (gte mso 9)|(IE)]= ></td></tr></table><!= [endif]= --> </div> <!--POWERINBOX 600x90--> </div> </td> </tr> <tr> <td width=3D"100%" valign=3D"top" align=3D"center" height=3D"30" style= =3D"height: 30px;"> =20 </td> </tr> <tr> <td width=3D"100%" valign=3D"top" align=3D"center" style=3D"padding-bottom: 20px; border-bottom: 5px solid #000;"> <a href=3D"http://click1.e.hw-commercialdesign.com/ddcldhzjtpmfsmrhfrkm= hfzmmzfmpsrlbtctwbdtphtgmj_rgnknjjlcvpcvgtcrnrjj.html" name=3D"" style=3D"c= olor: #000; text-decoration: none;" data-cms-ai=3D"0"> <img src=3D"https://cdnassets.hw.net/5b/f2/0fcd74f94927883a36c1c3aa7f4c/arc= hitect-newsletter-config.png" width=3D"341" height=3D"57" border=3D"0" vspa= ce=3D"8" alt=3D"Architect Newswire" style=3D"vertical-align: bottom; max-wi= dth: 456px; height: auto; margin-top: 0px; margin-bottom: 0" class=3D"mobil= eLogoImg"/> </a> </td> </tr> <tr> <td height=3D"18"> </td> </tr> <tr> <td width=3D"100%" valign=3D"top" class=3D"extra-paddin= g"> <table width=3D"100%" border=3D"0" cellspacing=3D"0= " cellpadding=3D"0"> <tr> <td width=3D"100%" colspan=3D"3" style=3D"border-collapse: collapse; mso-table-lspace: 0pt; mso-tabl= e-rspace: 0pt;"> <table width=3D"100%" cellspacing=3D"0" cellpadding=3D"0"> <tbody> <tr> <td class=3D"mobileColToRow extra-padding" width=3D"300= " valign=3D"top" style=3D"padding-left: 0; width: 300px;"> <div class=3D"mobileThumbnail" style=3D"width: 300p= x; overflow: hidden;"> <a href=3D"http://click1.e.hw-commercialdesign.com/lhwfwgshmknrqndgrdpngrsn= nsrnkqdflmjmclwmkgmzwz_rgnknjjlcvpcvgtcrnrjj.html" xt=3D"SPCLICK" name=3D"n= nn1" style=3D"color:#000 !important; text-decoration: none !important;" dat= a-cms-ai=3D"0"><img src=3D"https://cdnassets.hw.net/dims4/GG/6425404/214748= 3647/thumbnail/300x200%3E/quality/90/?url=3Dhttps%3A%2F%2Fcdnassets.hw.net%= 2Fd1%2F8c%2Fe6608f1646c6ab13df5ad0480b92%2F0522c-ar-aiaassocawards-hero.jpg= " width=3D"300" height=3D"200" border=3D"0" alt=3D"2022 AIA Associates Awar= d: Julian T. Owens, Emily McGee, Jennifer Peeler Truman" data-size=3D"promo= _300x200"></a> </div> </td> <td style=3D"border-collapse: collapse; mso-table-lspac= e: 0pt; mso-table-rspace: 0pt;"> <table class=3D"img-spacer" width=3D"12" align=3D"c= enter" style=3D"width: 12px; height: 0;"> <tr> <td> </td> </tr> </table> </td> <td class=3D"mobileColToRow" width=3D"303" colspan=3D"1= " rowspan=3D"1" valign=3D"top" style=3D"clear: both; padding-left: 0; "> <table width=3D"100%"> <tbody> <tr> <td class=3D"eyebrow" style=3D"color:= #ed1f24; padding-bottom: 5px;"> <p style=3D"display: inline-block= !important; color: #ed1f24 !important; margin-top: 0; margin-bottom: 0 !im= portant; font-size: 0.7em; font-weight: bold; text-transform: uppercase;"> <span style=3D"display: inline-= block; color: #ed1f24;"> 2022 AIA Awards </span> </p> </td> </tr> <tr> <td style=3D"color: #000000 !important;= "> <h2 style=3D"display: inline-block= !important; color: #000000; margin-top: 0; margin-bottom: 0 !important;=20= font-size: 1.4em; font-weight: bold; line-height: 1.1em;"> <a href=3D"http://click1.e.hw-commercialdesign.com/pvdrcjwvhqlbdlyjbytljbwl= lwblqdyrghmhkgchqjhfch_rgnknjjlcvpcvgtcrnrjj.html" xt=3D"SPCLICK" name=3D"n= nn2" style=3D"color: #000000 !important; text-decoration: none !important;"= data-cms-ai=3D"0"> <span=20= style=3D"color: #000000; text-decoration: none;"> 2022 AIA Associates Awa= rd: Julian T. Owens, Emily McGee, Jennifer Peeler Truman </span> </a> </h2> </td> </tr> <tr> <td style=3D"color: #6c6c6c !important;= "> <p style=3D"margin-top: 0; margin-b= ottom: 0 !important; font-size: 0.9em; color: #6c6c6c !important; line-heig= ht: 1.5em;"> <span style=3D"color: #6c6c6c;"= > "It=E2=80=99s less about ada= pting to today=E2=80=99s challenges as architects and designers and more=20= about intentionally learning and gaining an understanding of… </span> <a href=3D"http://click1.e.hw-commercialdesign.com/ucczpwvchqfsmfgwsgbfwsvf= fvsfqmgzjhnhkjphqwhypq_rgnknjjlcvpcvgtcrnrjj.html" xt=3D"SPCLICK" name=3D"n= nn3" style=3D"display: inline-block !important; color: #00aeed !important;= text-decoration: none !important;" class=3D"moreLink" data-cms-ai=3D"0">= <span class=3D"moreLink" style=3D"display: inl= ine-block; color: #00aeed; text-decoration: none; text-transform: uppercase= ;"> Read More </span> </a> </p> </td> </tr> </tbody> </table> </td> </tr> </tbody> </table> </td> </tr> <tr> <td height=3D"18"> </td> </tr> <tr> <td width=3D"100%" colspan=3D"3" style=3D"border-collapse: collapse; mso-table-lspace: 0pt; mso-tabl= e-rspace: 0pt;"> <table width=3D"100%" cellspacing=3D"0" cellpadding=3D"0"> <tbody> <tr> <td class=3D"mobileColToRow extra-padding" width=3D"300= " valign=3D"top" style=3D"padding-left: 0; width: 300px;"> <div class=3D"mobileThumbnail" style=3D"width: 300p= x; overflow: hidden;"> <a href=3D"http://click1.e.hw-commercialdesign.com/eddvzyjqrshfphtyftlhyfjh= hjfhsptvcrbrwczrsyrdzy_rgnknjjlcvpcvgtcrnrjj.html" xt=3D"SPCLICK" name=3D"n= nn4" style=3D"color:#000 !important; text-decoration: none !important;" dat= a-cms-ai=3D"0"><img src=3D"https://cdnassets.hw.net/dims4/GG/34ed951/214748= 3647/thumbnail/300x200%3E/quality/90/?url=3Dhttps%3A%2F%2Fcdnassets.hw.net%= 2Fcc%2Fc5%2F9553eb3e46c9afaa7af77a2f4fff%2Fcentria-west-pearland-library-12= 00x800.jpg" width=3D"300" height=3D"200" border=3D"0" alt=3D"Delivering a= Modern Facade Solution for a Texas Library" data-size=3D"promo_300x200"></= a> </div> </td> <td style=3D"border-collapse: collapse; mso-table-lspac= e: 0pt; mso-table-rspace: 0pt;"> <table class=3D"img-spacer" width=3D"12" align=3D"c= enter" style=3D"width: 12px; height: 0;"> <tr> <td> </td> </tr> </table> </td> <td class=3D"mobileColToRow" width=3D"303" colspan=3D"1= " rowspan=3D"1" valign=3D"top" style=3D"clear: both; padding-left: 0; "> <table width=3D"100%"> <tbody> <tr> <td class=3D"eyebrow" style=3D"color:= #ed1f24; padding-bottom: 5px;"> <p style=3D"display: inline-block= !important; color: #ed1f24 !important; margin-top: 0; margin-bottom: 0 !im= portant; font-size: 0.7em; font-weight: bold; text-transform: uppercase;"> <span style=3D"display: inline-= block; color: #ed1f24;"> brought to you by CENTRIA </span> </p> </td> </tr> <tr> <td style=3D"color: #000000 !important;= "> <h2 style=3D"display: inline-block= !important; color: #000000; margin-top: 0; margin-bottom: 0 !important;=20= font-size: 1.4em; font-weight: bold; line-height: 1.1em;"> <a href=3D"http://click1.e.hw-commercialdesign.com/mwczbympcqdlsdtyltgdylmd= dmldqstzjcncvjbcqycwbt_rgnknjjlcvpcvgtcrnrjj.html" xt=3D"SPCLICK" name=3D"n= nn5" style=3D"color: #000000 !important; text-decoration: none !important;"= data-cms-ai=3D"0"> <span=20= style=3D"color: #000000; text-decoration: none;"> Delivering a Modern Faca= de Solution for a Texas Library </span> </a> </h2> </td> </tr> <tr> <td style=3D"color: #6c6c6c !important;= "> <p style=3D"margin-top: 0; margin-b= ottom: 0 !important; font-size: 0.9em; color: #6c6c6c !important; line-heig= ht: 1.5em;"> <span style=3D"color: #6c6c6c;"= > The New West Pearland Librar= y Outside Houston </span> <a href=3D"http://click1.e.hw-commercialdesign.com/edsvzyjqrshfphtyftlhyfjh= hjfhsptvcrbrwczrsyrdzb_rgnknjjlcvpcvgtcrnrjj.html" xt=3D"SPCLICK" name=3D"n= nn6" style=3D"display: inline-block !important; color: #00aeed !important;= text-decoration: none !important;" class=3D"moreLink" data-cms-ai=3D"0">= <span class=3D"moreLink" style=3D"display: inl= ine-block; color: #00aeed; text-decoration: none; text-transform: uppercase= ;"> Read More </span> </a> </p> </td> </tr> </tbody> </table> </td> </tr> </tbody> </table> </td> </tr> <tr> <td height=3D"18"> </td> </tr> <tr> <td class=3D"50-50" width=3D"100%" colspan=3D"3" style=3D"border-collapse: collapse; mso-table-lspace: 0pt; mso-tabl= e-rspace: 0pt; padding-bottom: 18px;"> <table width=3D"100%" border=3D"0" cellspacing=3D"0" cellpadding=3D= "0"> <tr> <td class=3D"mobileColToRow" align=3D"left" valign=3D"top" style=3D"border-= collapse: collapse; mso-table-lspace: 0pt; mso-table-rspace: 0pt; margin-to= p: 0; margin-right: 0; margin-bottom: 0; margin-left: 0; padding-top: 0;=20= padding-right: 0; padding-bottom: 0; padding-left: 0;"> <table border=3D"0" cellspacing=3D"0" cellpadding=3D"0" width=3D"300"> <tbody> <tr> <th style=3D"color: #000 !important; float: left; padding-left:= 5px; padding-bottom: 5px; font: 9pt arial;"> =20 </th> </tr> <tr> <td class=3D"mobileColToRow extra-padding" rowspan=3D"1" colspan=3D"1" valign=3D"top" style=3D"width: 300px; padding-left: 0px; "> <div class=3D"mobileThumbnail" style=3D"width: 300px; overflow: hidden;"> <a href=3D"http://click1.e.hw-commercialdesign.com/ofjcrjsqtzldmlkjdkgljdsl= lsdlzmkcptwtnprtzjtfrl_rgnknjjlcvpcvgtcrnrjj.html" xt=3D"SPCLICK" name=3D"n= nn7" style=3D"color:#000 !important; text-decoration: none !important;" dat= a-cms-ai=3D"0"><img src=3D"https://cdnassets.hw.net/dims4/GG/a586800/214748= 3647/thumbnail/300x200%3E/quality/90/?url=3Dhttps%3A%2F%2Fcdnassets.hw.net%= 2F44%2F8b%2Fc9a232a9469e95169e449044abca%2Faia-hero-2020-black-on-red.jpg"= width=3D"300" height=3D"200" border=3D"0" alt=3D"Meet the Winners of the= 2022 AIA Election" data-size=3D"promo_300x200"></a> </div> </td> </tr> <tr> <td style=3D"font-size: 0"> <table class=3D"img-spacer" height=3D"3" align=3D"center"= style=3D"height: 3px; font-size: 0;"><tr><td> </td></tr></table> </td> </tr> <tr> <td class=3D"eyebrow-padding eyebrow" style=3D"color: #ed1f24;= padding-bottom: 5px;"> <p style=3D"display: inline-block !important; color: #ed1f2= 4 !important; margin-top: 0; margin-bottom: 0 !important; font-size: 0.7em;= font-weight: bold; text-transform: uppercase;"> <span style=3D"display: inline-block; color: #ed1f24;">= Press Release</span> </p> </td> </tr> <tr> <td style=3D"color: #000000 !important;"> <h2 style=3D"display: inline-block !important; color: #0000= 00; margin-top: 0; margin-bottom: 0 !important; font-size: 1.4em; font-weig= ht: bold; line-height: 1.1em;"> <a href=3D"http://click1.e.hw-commercialdesign.com/qnvjpsydmwfthfvstvqfstyf= fytfwhvjcmgmrcpmwsmnpp_rgnknjjlcvpcvgtcrnrjj.html" xt=3D"SPCLICK" name=3D"n= nn8" style=3D"color: #000000 !important; text-decoration: none !important;"= data-cms-ai=3D"0"> <span style=3D"color: #000000;= text-decoration: none;">Meet the Winners of the 2022 AIA Election</span> </a> </h2> </td> </tr> <tr> <td style=3D"color: #6c6c6c !important;"> <p style=3D"margin-top: 0; margin-bottom: 0 !important; fon= t-size: 0.9em; color: #6c6c6c !important; line-height: 1.5em;"> <span style=3D"color: #6c6c6c;">American Institute of= Architects delegates elected Kimberly Dowdell as the 2024 president-elect,= Britt Lindberg as the 2023=E2=80=932024 secretary, and…</span> <a href=3D"http://click1.e.hw-commercialdesign.com/nwdcrfgkqypnjptfnthpfngp= pgnpyjtcbqdqmbrqyfqwrj_rgnknjjlcvpcvgtcrnrjj.html" xt=3D"SPCLICK" name=3D"n= nn9" style=3D"display: inline-block !important; color: #00aeed !important;= text-decoration: none !important;" class=3D"moreLink" data-cms-ai=3D"0">= <span class=3D"moreLink" style=3D"display: inline-b= lock; color: #00aeed; text-decoration: none; text-transform: uppercase;">Re= ad More</span> </a> </p> </td> </tr> </tbody> </table> </td> <td> <table class=3D"spacer" width=3D"12" align=3D"c= enter" style=3D"width: 12px; height: 0;"> <tr> <td> </td> </tr> </table> </td> <td class=3D"mobileAdwrapper" align=3D"right" valign=3D"top" style=3D"borde= r-collapse: collapse; mso-table-lspace: 0pt; mso-table-rspace: 0pt; margin-= top: 0; margin-right: 0; margin-bottom: 0; margin-left: 0; padding-top: 0;= padding-right: 0; padding-bottom: 0; padding-left: 0;"> <table align=3D"center" style=3D"font: 7pt arial" bgcolor=3D"#ffffff"= border=3D"0" cellspacing=3D"0" cellpadding=3D"0" width=3D"300"> <tbody> <tr> <th style=3D"color:#000000 !important; float: left; padding-lef= t: 5px; padding-bottom: 5px;"> Advertisement </th> </tr> <tr> <td> <!-- POWERINBOX 300x250 --> <div class=3D"pi_17424 powerinbox"> <!-- domain: rs-stripe.architectmagazine.com --> <table width=3D"300" border=3D"0" cellpadding=3D"0" cellspacing=3D"0"> <tr> <td align=3D"center"> <a href=3D"http://click1.e.hw-commercialdesign.com/twcdmhsplzckjcbh= kbfchksccskczjbdtlvlrtmlzhlwmp_rgnknjjlcvpcvgtcrnrjj.html?a=3Delvis%40ebaar= chitects.org&b=3D50859" style=3D"border-style: none; outline: none; text-de= coration: none;" target=3D"_blank" ref=3D"nofollow"><img alt=3D"" height=3D= "250" src=3D"https://rs-stripe.architectmagazine.com/stripe/image?cs_email= =3Delvis@ebaarchitects.org&cs_sendid=3D50859&cs_esp=3Dpostup&cs_offset=3D0&= cs_stripeid=3D17424&dfp_nl_send_date=3D07/05/2022" style=3D"display: block;= border: 0; height: auto; line-height: 100%; outline: none; text-decoration= : none;" width=3D"300"></a> </td> </tr> </table> </div> <!-- POWERINBOX 300x250 --> </td> </tr> </tbody> </table> </td> </tr> </table> </td> </tr> <tr> <td height=3D"18"> </td> </tr> <tr> <td width=3D"100%" colspan=3D"3" style=3D"border-collapse: collapse; mso-table-lspace: 0pt; mso-tabl= e-rspace: 0pt;"> <table width=3D"100%" cellspacing=3D"0" cellpadding=3D"0"> <tbody> <tr> <td class=3D"mobileColToRow extra-padding" width=3D"300= " valign=3D"top" style=3D"padding-left: 0; width: 300px;"> <div class=3D"mobileThumbnail" style=3D"width: 300p= x; overflow: hidden;"> <a href=3D"http://click1.e.hw-commercialdesign.com/vvmqjpdyfvgnmgkpnkbgpndg= gdngvmkqcfhfzcjfvpfrmr_rgnknjjlcvpcvgtcrnrjj.html" xt=3D"SPCLICK" name=3D"n= nn10" style=3D"color:#000 !important; text-decoration: none !important;"=20= data-cms-ai=3D"0"><img src=3D"https://cdnassets.hw.net/dims4/GG/6254eb4/214= 7483647/thumbnail/300x200%3E/quality/90/?url=3Dhttps%3A%2F%2Fcdnassets.hw.n= et%2F5f%2F34%2F66ff223646e49e6a1fc38dd86c62%2Fdmg46-beautyshot-hvhz-1200x80= 0.jpg" width=3D"300" height=3D"200" border=3D"0" alt=3D"Designing for Wind-= Borne Impact" data-size=3D"promo_300x200"></a> </div= > </td> <td style=3D"border-collapse: collapse; mso-table-lspac= e: 0pt; mso-table-rspace: 0pt;"> <table class=3D"img-spacer" width=3D"12" align=3D"c= enter" style=3D"width: 12px; height: 0;"> <tr> <td> </td> </tr> </table> </td> <td class=3D"mobileColToRow" width=3D"303" colspan=3D"1= " rowspan=3D"1" valign=3D"top" style=3D"clear: both; padding-left: 0; "> <table width=3D"100%"> <tbody> <tr> <td class=3D"eyebrow" style=3D"color:= #ed1f24; padding-bottom: 5px;"> <p style=3D"display: inline-block= !important; color: #ed1f24 !important; margin-top: 0; margin-bottom: 0 !im= portant; font-size: 0.7em; font-weight: bold; text-transform: uppercase;"> <span style=3D"display: inline-= block; color: #ed1f24;"> brought to you by Plastpro </span> </p> </td> </tr> <tr> <td style=3D"color: #000000 !important;= "> <h2 style=3D"display: inline-block= !important; color: #000000; margin-top: 0; margin-bottom: 0 !important;=20= font-size: 1.4em; font-weight: bold; line-height: 1.1em;"> <a href=3D"http://click1.e.hw-commercialdesign.com/qwdjpsydmwfthfvstvqfstyf= fytfwhvjcmgmrcpmwsmnhm_rgnknjjlcvpcvgtcrnrjj.html" xt=3D"SPCLICK" name=3D"n= nn11" style=3D"color: #000000 !important; text-decoration: none !important;= " data-cms-ai=3D"0"> <span= style=3D"color: #000000; text-decoration: none;"> Designing for Wind-Borne= Impact </span> </a> </h2> </td> </tr> <tr> <td style=3D"color: #6c6c6c !important;= "> <p style=3D"margin-top: 0; margin-b= ottom: 0 !important; font-size: 0.9em; color: #6c6c6c !important; line-heig= ht: 1.5em;"> <span style=3D"color: #6c6c6c;"= > Next generation front doors reima= gine style and strength in tornado and hurricane zones. </span> <a href=3D"http://click1.e.hw-commercialdesign.com/eydvzyjqrshfphtyftlhyfjh= hjfhsptvcrbrwczrsyrdps_rgnknjjlcvpcvgtcrnrjj.html" xt=3D"SPCLICK" name=3D"n= nn12" style=3D"display: inline-block !important; color: #00aeed !important;= text-decoration: none !important;" class=3D"moreLink" data-cms-ai=3D"0">= <span class=3D"moreLink" style=3D"display: inl= ine-block; color: #00aeed; text-decoration: none; text-transform: uppercase= ;"> Read More </span> </a> </p> </td> </tr> </tbody> </table> </td> </tr> </tbody> </table> </td> </tr> <tr> <td height=3D"18"> </td> </tr> <tr> <td width=3D"100%" colspan=3D"3" style=3D"border-collapse: collapse; mso-table-lspace: 0pt; mso-tabl= e-rspace: 0pt;"> <table width=3D"100%" cellspacing=3D"0" cellpadding=3D"0"> <tbody> <tr> <td class=3D"mobileColToRow extra-padding" width=3D"300= " valign=3D"top" style=3D"padding-left: 0; width: 300px;"> <div class=3D"mobileThumbnail" style=3D"width: 300p= x; overflow: hidden;"> <a href=3D"http://click1.e.hw-commercialdesign.com/nfqcrfgkqypnjptfnthpfngp= pgnpyjtcbqdqmbrqyfqwjf_rgnknjjlcvpcvgtcrnrjj.html" xt=3D"SPCLICK" name=3D"n= nn13" style=3D"color:#000 !important; text-decoration: none !important;"=20= data-cms-ai=3D"0"><img src=3D"https://cdnassets.hw.net/dims4/GG/86e7d4f/214= 7483647/thumbnail/300x200%3E/quality/90/?url=3Dhttps%3A%2F%2Fcdnassets.hw.n= et%2F5d%2F1e%2F810efed84e4e9d469077422bbc03%2Favl-the-clever-lamp-04.jpg"= width=3D"300" height=3D"200" border=3D"0" alt=3D"Designers Select: Nine=20= Stellar Lighting Picks" data-size=3D"promo_300x200"></a> =20= </div> </td> <td style=3D"border-collapse: collapse; mso-table-lspac= e: 0pt; mso-table-rspace: 0pt;"> <table class=3D"img-spacer" width=3D"12" align=3D"c= enter" style=3D"width: 12px; height: 0;"> <tr> <td> </td> </tr> </table> </td> <td class=3D"mobileColToRow" width=3D"303" colspan=3D"1= " rowspan=3D"1" valign=3D"top" style=3D"clear: both; padding-left: 0; "> <table width=3D"100%"> <tbody> <tr> <td class=3D"eyebrow" style=3D"color:= #ed1f24; padding-bottom: 5px;"> <p style=3D"display: inline-block= !important; color: #ed1f24 !important; margin-top: 0; margin-bottom: 0 !im= portant; font-size: 0.7em; font-weight: bold; text-transform: uppercase;"> <span style=3D"display: inline-= block; color: #ed1f24;"> Shining Stars </span> </p> </td> </tr> <tr> <td style=3D"color: #000000 !important;= "> <h2 style=3D"display: inline-block= !important; color: #000000; margin-top: 0; margin-bottom: 0 !important;=20= font-size: 1.4em; font-weight: bold; line-height: 1.1em;"> <a href=3D"http://click1.e.hw-commercialdesign.com/ojzcrjsqtzldmlkjdkgljdsl= lsdlzmkcptwtnprtzjtfmk_rgnknjjlcvpcvgtcrnrjj.html" xt=3D"SPCLICK" name=3D"n= nn14" style=3D"color: #000000 !important; text-decoration: none !important;= " data-cms-ai=3D"0"> <span= style=3D"color: #000000; text-decoration: none;"> Designers Select: Nine= Stellar Lighting Picks </span> </a> </h2> </td> </tr> <tr> <td style=3D"color: #6c6c6c !important;= "> <p style=3D"margin-top: 0; margin-b= ottom: 0 !important; font-size: 0.9em; color: #6c6c6c !important; line-heig= ht: 1.5em;"> <span style=3D"color: #6c6c6c;"= > Read more about the top work= place, hospitality, and residential luminaires from New York designers Jame= s Cull, Katherine Mendez, and Krista Ninivaggi. </span> <a href=3D"http://click1.e.hw-commercialdesign.com/uwwzpwvchqfsmfgwsgbfwsvf= fvsfqmgzjhnhkjphqwhymn_rgnknjjlcvpcvgtcrnrjj.html" xt=3D"SPCLICK" name=3D"n= nn15" style=3D"display: inline-block !important; color: #00aeed !important;= text-decoration: none !important;" class=3D"moreLink" data-cms-ai=3D"0">= <span class=3D"moreLink" style=3D"display: inl= ine-block; color: #00aeed; text-decoration: none; text-transform: uppercase= ;"> Read More </span> </a> </p> </td> </tr> </tbody> </table> </td> </tr> </tbody> </table> </td> </tr> <tr> <td height=3D"18"> </td> </tr> <tr> <td class=3D"50-50" width=3D"100%" colspan=3D"3" style=3D"border-collapse: collapse; mso-table-lspace: 0pt; mso-tabl= e-rspace: 0pt; padding-bottom: 18px;"> <table width=3D"100%" border=3D"0" cellspacing=3D"0" cellpadding=3D= "0"> <tr> <td class=3D"mobileColToRow" align=3D"left" valign=3D"top" style=3D"border-= collapse: collapse; mso-table-lspace: 0pt; mso-table-rspace: 0pt; margin-to= p: 0; margin-right: 0; margin-bottom: 0; margin-left: 0; padding-top: 0;=20= padding-right: 0; padding-bottom: 0; padding-left: 0;"> <table border=3D"0" cellspacing=3D"0" cellpadding=3D"0" width=3D"300"> <tbody> <tr> <th style=3D"color: #000 !important; float: left; padding-left:= 5px; padding-bottom: 5px; font: 9pt arial;"> =20 </th> </tr> <tr> <td class=3D"mobileColToRow extra-padding" rowspan=3D"1" colspan=3D"1" valign=3D"top" style=3D"width: 300px; padding-left: 0px; "> <div class=3D"mobileThumbnail" style=3D"width: 300px; overflow: hidden;"> <a href=3D"http://click1.e.hw-commercialdesign.com/xhpnjhkcdvbtsbphtplbhtkb= bktbvspnydrdqyjdvhdgsb_rgnknjjlcvpcvgtcrnrjj.html" xt=3D"SPCLICK" name=3D"n= nn16" style=3D"color:#000 !important; text-decoration: none !important;"=20= data-cms-ai=3D"0"><img src=3D"https://cdnassets.hw.net/dims4/GG/6b1e33a/214= 7483647/thumbnail/300x200%3E/quality/90/?url=3Dhttps%3A%2F%2Fcdnassets.hw.n= et%2Faf%2F50%2F2c004e0e4e9cb7c533be7ff3d026%2F0522c-ar-aiaprofiles-robertei= senstat-bymattcarr.jpg" width=3D"300" height=3D"200" border=3D"0" alt=3D"20= 22 Award for Excellence in Public Architecture: Robert Eisenstat" data-size= =3D"promo_300x200"></a> </div> </td> </tr> <tr> <td style=3D"font-size: 0"> <table class=3D"img-spacer" height=3D"3" align=3D"center"= style=3D"height: 3px; font-size: 0;"><tr><td> </td></tr></table> </td> </tr> <tr> <td class=3D"eyebrow-padding eyebrow" style=3D"color: #ed1f24;= padding-bottom: 5px;"> <p style=3D"display: inline-block !important; color: #ed1f2= 4 !important; margin-top: 0; margin-bottom: 0 !important; font-size: 0.7em;= font-weight: bold; text-transform: uppercase;"> <span style=3D"display: inline-block; color: #ed1f24;">= 2022 AIA Awards</span> </p> </td> </tr> <tr> <td style=3D"color: #000000 !important;"> <h2 style=3D"display: inline-block !important; color: #0000= 00; margin-top: 0; margin-bottom: 0 !important; font-size: 1.4em; font-weig= ht: bold; line-height: 1.1em;"> <a href=3D"http://click1.e.hw-commercialdesign.com/mynzbympcqdlsdtyltgdylmd= dmldqstzjcncvjbcqycwsb_rgnknjjlcvpcvgtcrnrjj.html" xt=3D"SPCLICK" name=3D"n= nn17" style=3D"color: #000000 !important; text-decoration: none !important;= " data-cms-ai=3D"0"> <span style=3D"color: #000000;= text-decoration: none;">2022 Award for Excellence in Public Architecture:= Robert Eisenstat</span> </a> </h2> </td> </tr> <tr> <td style=3D"color: #6c6c6c !important;"> <p style=3D"margin-top: 0; margin-bottom: 0 !important; fon= t-size: 0.9em; color: #6c6c6c !important; line-height: 1.5em;"> <span style=3D"color: #6c6c6c;">"As professionals who= care about and design the public realm, we should represent the concerns= of the public=E2=80=94whether we are functioning as…</span> <a href=3D"http://click1.e.hw-commercialdesign.com/fhncghtydsnwrnbhwbznhwtn= ntwnsrbcpdjdlpgdshdqrr_rgnknjjlcvpcvgtcrnrjj.html" xt=3D"SPCLICK" name=3D"n= nn18" style=3D"display: inline-block !important; color: #00aeed !important;= text-decoration: none !important;" class=3D"moreLink" data-cms-ai=3D"0">= <span class=3D"moreLink" style=3D"display: inline-b= lock; color: #00aeed; text-decoration: none; text-transform: uppercase;">Re= ad More</span> </a> </p> </td> </tr> </tbody> </table> </td> <td> <table class=3D"spacer" width=3D"12" align=3D"c= enter" style=3D"width: 12px; height: 0;"> <tr> <td> </td> </tr> </table> </td> <td class=3D"mobileAdwrapper" align=3D"right" valign=3D"top" style=3D"borde= r-collapse: collapse; mso-table-lspace: 0pt; mso-table-rspace: 0pt; margin-= top: 0; margin-right: 0; margin-bottom: 0; margin-left: 0; padding-top: 0;= padding-right: 0; padding-bottom: 0; padding-left: 0;"> <table align=3D"center" style=3D"font: 7pt arial" bgcolor=3D"#ffffff"= border=3D"0" cellspacing=3D"0" cellpadding=3D"0" width=3D"300"> <tbody> <tr> <th style=3D"color:#000000 !important; float: left; padding-lef= t: 5px; padding-bottom: 5px;"> Advertisement </th> </tr> <tr> <td> <!-- POWERINBOX 300x250 --> <div class=3D"pi_17425 powerinbox"> <!-- domain: rs-stripe.architectmagazine.com --> <table width=3D"300" border=3D"0" cellpadding=3D"0" cellspacing=3D"0"> <tr> <td align=3D"center"> <a href=3D"http://click1.e.hw-commercialdesign.com/bfcscfvzplqybqjf= yjkqfyvqqvyqlbjsnpgpmncplfpdbz_rgnknjjlcvpcvgtcrnrjj.html?a=3Delvis%40ebaar= chitects.org&b=3D50859" style=3D"border-style: none; outline: none; text-de= coration: none;" target=3D"_blank" ref=3D"nofollow" data-cms-ai=3D"0"><img= alt=3D"" height=3D"250" src=3D"https://rs-stripe.architectmagazine.com/str= ipe/image?cs_email=3Delvis@ebaarchitects.org&cs_sendid=3D50859&cs_esp=3Dpos= tup&cs_offset=3D0&cs_stripeid=3D17425&dfp_nl_send_date=3D07/05/2022" style= =3D"display: block; border: 0; height: auto; line-height: 100%; outline:=20= none; text-decoration: none;" width=3D"300"></a> </td> </tr> </table> </div> <!-- POWERINBOX 300x250 --> </td> </tr> </tbody> </table> </td> </tr> </table> </td> </tr> <tr> <td height=3D"18"> </td> </tr> <tr> <td width=3D"100%" colspan=3D"3" style=3D"border-collapse: collapse; mso-table-lspace: 0pt; mso-tabl= e-rspace: 0pt;"> <table width=3D"100%" cellspacing=3D"0" cellpadding=3D"0"> <tbody> <tr> <td class=3D"mobileColToRow extra-padding" width=3D"300= " valign=3D"top" style=3D"padding-left: 0; width: 300px;"> <div class=3D"mobileThumbnail" style=3D"width: 300p= x; overflow: hidden;"> <a href=3D"http://click1.e.hw-commercialdesign.com/qgdjpsydmwfthfvstvqfstyf= fytfwhvjcmgmrcpmwsmndn_rgnknjjlcvpcvgtcrnrjj.html" xt=3D"SPCLICK" name=3D"n= nn19" style=3D"color:#000 !important; text-decoration: none !important;"=20= data-cms-ai=3D"0"><img src=3D"https://cdnassets.hw.net/dims4/GG/bec4c63/214= 7483647/thumbnail/300x200%3E/quality/90/?url=3Dhttps%3A%2F%2Fcdnassets.hw.n= et%2Ff1%2Fa8%2F39a402724bd8a93f9dd10a381a44%2F4wayhouse-deegandaydesign-1q5= a7256.jpg" width=3D"300" height=3D"200" border=3D"0" alt=3D"4/Way House,=20= by Deegan-Day Design & Architecture" data-size=3D"promo_300x200"></a> =20= </div> </td> <td style=3D"border-collapse: collapse; mso-table-lspac= e: 0pt; mso-table-rspace: 0pt;"> <table class=3D"img-spacer" width=3D"12" align=3D"c= enter" style=3D"width: 12px; height: 0;"> <tr> <td> </td> </tr> </table> </td> <td class=3D"mobileColToRow" width=3D"303" colspan=3D"1= " rowspan=3D"1" valign=3D"top" style=3D"clear: both; padding-left: 0; "> <table width=3D"100%"> <tbody> <tr> <td class=3D"eyebrow" style=3D"color:= #ed1f24; padding-bottom: 5px;"> <p style=3D"display: inline-block= !important; color: #ed1f24 !important; margin-top: 0; margin-bottom: 0 !im= portant; font-size: 0.7em; font-weight: bold; text-transform: uppercase;"> <span style=3D"display: inline-= block; color: #ed1f24;"> Single Family Project </span> </p> </td> </tr> <tr> <td style=3D"color: #000000 !important;= "> <h2 style=3D"display: inline-block= !important; color: #000000; margin-top: 0; margin-bottom: 0 !important;=20= font-size: 1.4em; font-weight: bold; line-height: 1.1em;"> <a href=3D"http://click1.e.hw-commercialdesign.com/gtwjlgsmcytdntkgdkqtgdst= tsdtynkjfcrcpflcygcwmc_rgnknjjlcvpcvgtcrnrjj.html" xt=3D"SPCLICK" name=3D"n= nn20" style=3D"color: #000000 !important; text-decoration: none !important;= " data-cms-ai=3D"0"> <span= style=3D"color: #000000; text-decoration: none;"> 4/Way House, by Deegan-= Day Design & Architecture </span> </a> </h2> </td> </tr> <tr> <td style=3D"color: #6c6c6c !important;= "> <p style=3D"margin-top: 0; margin-b= ottom: 0 !important; font-size: 0.9em; color: #6c6c6c !important; line-heig= ht: 1.5em;"> <span style=3D"color: #6c6c6c;"= > A disaster-proofed, single=20= family project in Topanga, Calif., that explores the ethics and methods of= building on wildfire-prone land. </span> <a href=3D"http://click1.e.hw-commercialdesign.com/xbdnjhkcdvbtsbphtplbhtkb= bktbvspnydrdqyjdvhdgcv_rgnknjjlcvpcvgtcrnrjj.html" xt=3D"SPCLICK" name=3D"n= nn21" style=3D"display: inline-block !important; color: #00aeed !important;= text-decoration: none !important;" class=3D"moreLink" data-cms-ai=3D"0">= <span class=3D"moreLink" style=3D"display: inl= ine-block; color: #00aeed; text-decoration: none; text-transform: uppercase= ;"> Read More </span> </a> </p> </td> </tr> </tbody> </table> </td> </tr> </tbody> </table> </td> </tr> <tr> <td height=3D"18"> </td> </tr> <tr> <td width=3D"100%" colspan=3D"3" style=3D"border-collapse: collapse; mso-table-lspace: 0pt; mso-tabl= e-rspace: 0pt;"> <table width=3D"100%" cellspacing=3D"0" cellpadding=3D"0"> <tbody> <tr> <td class=3D"mobileColToRow extra-padding" width=3D"300= " valign=3D"top" style=3D"padding-left: 0; width: 300px;"> <div class=3D"mobileThumbnail" style=3D"width: 300p= x; overflow: hidden;"> <a href=3D"http://click1.e.hw-commercialdesign.com/fnscghtydsnwrnbhwbznhwtn= ntwnsrbcpdjdlpgdshdqyh_rgnknjjlcvpcvgtcrnrjj.html" xt=3D"SPCLICK" name=3D"n= nn22" style=3D"color:#000 !important; text-decoration: none !important;"=20= data-cms-ai=3D"0"><img src=3D"https://cdnassets.hw.net/dims4/GG/1d230fd/214= 7483647/thumbnail/300x200%3E/quality/90/?url=3Dhttps%3A%2F%2Fcdnassets.hw.n= et%2F16%2Fb0%2F23f9eeda419db38e64599abe4bb2%2Fmorgan-hero.jpg" width=3D"300= " height=3D"200" border=3D"0" alt=3D"A Restoration and Fresh Garden Bring= Light to The Morgan" data-size=3D"promo_300x200"></a> =20= </div> </td> <td style=3D"border-collapse: collapse; mso-table-lspac= e: 0pt; mso-table-rspace: 0pt;"> <table class=3D"img-spacer" width=3D"12" align=3D"c= enter" style=3D"width: 12px; height: 0;"> <tr> <td> </td> </tr> </table> </td> <td class=3D"mobileColToRow" width=3D"303" colspan=3D"1= " rowspan=3D"1" valign=3D"top" style=3D"clear: both; padding-left: 0; "> <table width=3D"100%"> <tbody> <tr> <td class=3D"eyebrow" style=3D"color:= #ed1f24; padding-bottom: 5px;"> <p style=3D"display: inline-block= !important; color: #ed1f24 !important; margin-top: 0; margin-bottom: 0 !im= portant; font-size: 0.7em; font-weight: bold; text-transform: uppercase;"> <span style=3D"display: inline-= block; color: #ed1f24;"> Art & Architecture </span> </p> </td> </tr> <tr> <td style=3D"color: #000000 !important;= "> <h2 style=3D"display: inline-block= !important; color: #000000; margin-top: 0; margin-bottom: 0 !important;=20= font-size: 1.4em; font-weight: bold; line-height: 1.1em;"> <a href=3D"http://click1.e.hw-commercialdesign.com/lngfwgshmknrqndgrdpngrsn= nsrnkqdflmjmclwmkgmzhd_rgnknjjlcvpcvgtcrnrjj.html" xt=3D"SPCLICK" name=3D"n= nn23" style=3D"color: #000000 !important; text-decoration: none !important;= " data-cms-ai=3D"0"> <span= style=3D"color: #000000; text-decoration: none;"> A Restoration and Fresh= Garden Bring Light to The Morgan </span> </a> </h2> </td> </tr> <tr> <td style=3D"color: #6c6c6c !important;= "> <p style=3D"margin-top: 0; margin-b= ottom: 0 !important; font-size: 0.9em; color: #6c6c6c !important; line-heig= ht: 1.5em;"> <span style=3D"color: #6c6c6c;"= > A six-year restoration effort= =E2=80=94including landscape architect Todd Longstaffe-Gowan's first U.S.= project=E2=80=94at the New York Morgan Library & Museum… </span> <a href=3D"http://click1.e.hw-commercialdesign.com/qfvjpsydmwfthfvstvqfstyf= fytfwhvjcmgmrcpmwsmndg_rgnknjjlcvpcvgtcrnrjj.html" xt=3D"SPCLICK" name=3D"n= nn24" style=3D"display: inline-block !important; color: #00aeed !important;= text-decoration: none !important;" class=3D"moreLink" data-cms-ai=3D"0">= <span class=3D"moreLink" style=3D"display: inl= ine-block; color: #00aeed; text-decoration: none; text-transform: uppercase= ;"> Read More </span> </a> </p> </td> </tr> </tbody> </table> </td> </tr> </tbody> </table> </td> </tr> <tr> <td height=3D"18"> </td> </tr> <tr> <td width=3D"100%" colspan=3D"3" style=3D"border-collapse: collapse; mso-table-lspace: 0pt; mso-tabl= e-rspace: 0pt;"> <table width=3D"100%" cellspacing=3D"0" cellpadding=3D"0"> <tbody> <tr> <td class=3D"mobileColToRow extra-padding" width=3D"300= " valign=3D"top" style=3D"padding-left: 0; width: 300px;"> <div class=3D"mobileThumbnail" style=3D"width: 300p= x; overflow: hidden;"> <a href=3D"http://click1.e.hw-commercialdesign.com/gtrjlgsmcytdntkgdkqtgdst= tsdtynkjfcrcpflcygcwmt_rgnknjjlcvpcvgtcrnrjj.html" xt=3D"SPCLICK" name=3D"n= nn25" style=3D"color:#000 !important; text-decoration: none !important;"=20= data-cms-ai=3D"0"><img src=3D"https://cdnassets.hw.net/dims4/GG/a21dee2/214= 7483647/thumbnail/300x200%3E/quality/90/?url=3Dhttps%3A%2F%2Fcdnassets.hw.n= et%2F26%2Ff6%2Fc087f2864079941094fe7e634b2a%2F0522c-ar-aiaprofiles-ridingth= evortex-bychristiancarter-ross.jpg" width=3D"300" height=3D"200" border=3D"= 0" alt=3D"2022 AIA Whitney M. Young Jr. Award: Riding the Vortex" data-size= =3D"promo_300x200"></a> </div> </td> <td style=3D"border-collapse: collapse; mso-table-lspac= e: 0pt; mso-table-rspace: 0pt;"> <table class=3D"img-spacer" width=3D"12" align=3D"c= enter" style=3D"width: 12px; height: 0;"> <tr> <td> </td> </tr> </table> </td> <td class=3D"mobileColToRow" width=3D"303" colspan=3D"1= " rowspan=3D"1" valign=3D"top" style=3D"clear: both; padding-left: 0; "> <table width=3D"100%"> <tbody> <tr> <td class=3D"eyebrow" style=3D"color:= #ed1f24; padding-bottom: 5px;"> <p style=3D"display: inline-block= !important; color: #ed1f24 !important; margin-top: 0; margin-bottom: 0 !im= portant; font-size: 0.7em; font-weight: bold; text-transform: uppercase;"> <span style=3D"display: inline-= block; color: #ed1f24;"> 2022 AIA AWARDS </span> </p> </td> </tr> <tr> <td style=3D"color: #000000 !important;= "> <h2 style=3D"display: inline-block= !important; color: #000000; margin-top: 0; margin-bottom: 0 !important;=20= font-size: 1.4em; font-weight: bold; line-height: 1.1em;"> <a href=3D"http://click1.e.hw-commercialdesign.com/uffzpwvchqfsmfgwsgbfwsvf= fvsfqmgzjhnhkjphqwhycp_rgnknjjlcvpcvgtcrnrjj.html" xt=3D"SPCLICK" name=3D"n= nn26" style=3D"color: #000000 !important; text-decoration: none !important;= " data-cms-ai=3D"0"> <span= style=3D"color: #000000; text-decoration: none;"> 2022 AIA Whitney M. You= ng Jr. Award: Riding the Vortex </span> </a> </h2> </td> </tr> <tr> <td style=3D"color: #6c6c6c !important;= "> <p style=3D"margin-top: 0; margin-b= ottom: 0 !important; font-size: 0.9em; color: #6c6c6c !important; line-heig= ht: 1.5em;"> <span style=3D"color: #6c6c6c;"= > "If buildings, communities,= and cities are all designed from the same starting point philosophically,= culturally, and intellectually, we end up with… </span> <a href=3D"http://click1.e.hw-commercialdesign.com/ufpzpwvchqfsmfgwsgbfwsvf= fvsfqmgzjhnhkjphqwhycm_rgnknjjlcvpcvgtcrnrjj.html" xt=3D"SPCLICK" name=3D"n= nn27" style=3D"display: inline-block !important; color: #00aeed !important;= text-decoration: none !important;" class=3D"moreLink" data-cms-ai=3D"0">= <span class=3D"moreLink" style=3D"display: inl= ine-block; color: #00aeed; text-decoration: none; text-transform: uppercase= ;"> Read More </span> </a> </p> </td> </tr> </tbody> </table> </td> </tr> </tbody> </table> </td> </tr> <tr> <td height=3D"18"> </td> </tr> <tr> <td width=3D"100%" colspan=3D"3" style=3D"border-collapse: collapse; mso-table-lspace: 0pt; mso-tabl= e-rspace: 0pt;"> <table width=3D"100%" cellspacing=3D"0" cellpadding=3D"0"> <tbody> <tr> <td class=3D"mobileColToRow extra-padding" width=3D"300= " valign=3D"top" style=3D"padding-left: 0; width: 300px;"> <div class=3D"mobileThumbnail" style=3D"width: 300p= x; overflow: hidden;"> <a href=3D"http://click1.e.hw-commercialdesign.com/apsvtdrlmkpnspydnyzpdnrp= prnpksyvcmhmgctmkdmbll_rgnknjjlcvpcvgtcrnrjj.html" xt=3D"SPCLICK" name=3D"n= nn28" style=3D"color:#000 !important; text-decoration: none !important;"=20= data-cms-ai=3D"0"><img src=3D"https://cdnassets.hw.net/dims4/GG/58eb4c0/214= 7483647/thumbnail/300x200%3E/quality/90/?url=3Dhttps%3A%2F%2Fcdnassets.hw.n= et%2F72%2Fb4%2F6bd0f9c3420f99f9848cc346dc10%2F0522-ar-carbonpositive-hero.j= pg" width=3D"300" height=3D"200" border=3D"0" alt=3D"CarbonPositive: Retrof= itting Renewal and Transformation" data-size=3D"promo_300x200"></a> =20= </div> </td> <td style=3D"border-collapse: collapse; mso-table-lspac= e: 0pt; mso-table-rspace: 0pt;"> <table class=3D"img-spacer" width=3D"12" align=3D"c= enter" style=3D"width: 12px; height: 0;"> <tr> <td> </td> </tr> </table> </td> <td class=3D"mobileColToRow" width=3D"303" colspan=3D"1= " rowspan=3D"1" valign=3D"top" style=3D"clear: both; padding-left: 0; "> <table width=3D"100%"> <tbody> <tr> <td class=3D"eyebrow" style=3D"color:= #ed1f24; padding-bottom: 5px;"> <p style=3D"display: inline-block= !important; color: #ed1f24 !important; margin-top: 0; margin-bottom: 0 !im= portant; font-size: 0.7em; font-weight: bold; text-transform: uppercase;"> <span style=3D"display: inline-= block; color: #ed1f24;"> Climate Action </span> </p> </td> </tr> <tr> <td style=3D"color: #000000 !important;= "> <h2 style=3D"display: inline-block= !important; color: #000000; margin-top: 0; margin-bottom: 0 !important;=20= font-size: 1.4em; font-weight: bold; line-height: 1.1em;"> <a href=3D"http://click1.e.hw-commercialdesign.com/wwdtnvkjdlsbzswvbwqsvbks= skbslzwthdgdmhndlvddff_rgnknjjlcvpcvgtcrnrjj.html" xt=3D"SPCLICK" name=3D"n= nn29" style=3D"color: #000000 !important; text-decoration: none !important;= " data-cms-ai=3D"0"> <span= style=3D"color: #000000; text-decoration: none;"> CarbonPositive: Retrofit= ting Renewal and Transformation </span> </a> </h2> </td> </tr> <tr> <td style=3D"color: #6c6c6c !important;= "> <p style=3D"margin-top: 0; margin-b= ottom: 0 !important; font-size: 0.9em; color: #6c6c6c !important; line-heig= ht: 1.5em;"> <span style=3D"color: #6c6c6c;"= > With building codes changing= across the United States, Architecture 2030 senior fellow Carl Elefante=20= explains why architects should focus on… </span> <a href=3D"http://click1.e.hw-commercialdesign.com/ugqzpwvchqfsmfgwsgbfwsvf= fvsfqmgzjhnhkjphqwhhyh_rgnknjjlcvpcvgtcrnrjj.html" xt=3D"SPCLICK" name=3D"n= nn30" style=3D"display: inline-block !important; color: #00aeed !important;= text-decoration: none !important;" class=3D"moreLink" data-cms-ai=3D"0">= <span class=3D"moreLink" style=3D"display: inl= ine-block; color: #00aeed; text-decoration: none; text-transform: uppercase= ;"> Read More </span> </a> </p> </td> </tr> </tbody> </table> </td> </tr> </tbody> </table> </td> </tr> <tr> <td height=3D"18"> </td> </tr> <tr> <td width=3D"100%" colspan=3D"3" style=3D"border-collapse: collapse; mso-table-lspace: 0pt; mso-tabl= e-rspace: 0pt;"> <table width=3D"100%" cellspacing=3D"0" cellpadding=3D"0"> <tbody> <tr> <td class=3D"mobileColToRow extra-padding" width=3D"300= " valign=3D"top" style=3D"padding-left: 0; width: 300px;"> <div class=3D"mobileThumbnail" style=3D"width: 300p= x; overflow: hidden;"> <a href=3D"http://click1.e.hw-commercialdesign.com/zbpgwpvfrmlkdlbpkbjlpkvl= lvklmdbgcrsrqcwrmprrzm_rgnknjjlcvpcvgtcrnrjj.html" xt=3D"SPCLICK" name=3D"n= nn31" style=3D"color:#000 !important; text-decoration: none !important;"=20= data-cms-ai=3D"0"><img src=3D"https://cdnassets.hw.net/dims4/GG/5bdfb11/214= 7483647/thumbnail/300x200%3E/quality/90/?url=3Dhttps%3A%2F%2Fcdnassets.hw.n= et%2F2f%2F6f%2F5a0677cd406785e93754e8894f62%2Fspringproduct-hero-36refriger= ator.jpg" width=3D"300" height=3D"200" border=3D"0" alt=3D"Spring 2022 Prod= uct Call Highlights" data-size=3D"promo_300x200"></a> =20= </div> </td> <td style=3D"border-collapse: collapse; mso-table-lspac= e: 0pt; mso-table-rspace: 0pt;"> <table class=3D"img-spacer" width=3D"12" align=3D"c= enter" style=3D"width: 12px; height: 0;"> <tr> <td> </td> </tr> </table> </td> <td class=3D"mobileColToRow" width=3D"303" colspan=3D"1= " rowspan=3D"1" valign=3D"top" style=3D"clear: both; padding-left: 0; "> <table width=3D"100%"> <tbody> <tr> <td class=3D"eyebrow" style=3D"color:= #ed1f24; padding-bottom: 5px;"> <p style=3D"display: inline-block= !important; color: #ed1f24 !important; margin-top: 0; margin-bottom: 0 !im= portant; font-size: 0.7em; font-weight: bold; text-transform: uppercase;"> <span style=3D"display: inline-= block; color: #ed1f24;"> Products </span> </p> </td> </tr> <tr> <td style=3D"color: #000000 !important;= "> <h2 style=3D"display: inline-block= !important; color: #000000; margin-top: 0; margin-bottom: 0 !important;=20= font-size: 1.4em; font-weight: bold; line-height: 1.1em;"> <a href=3D"http://click1.e.hw-commercialdesign.com/pyyrcjwvhqlbdlyjbytljbwl= lwblqdyrghmhkgchqjhhfj_rgnknjjlcvpcvgtcrnrjj.html" xt=3D"SPCLICK" name=3D"n= nn32" style=3D"color: #000000 !important; text-decoration: none !important;= " data-cms-ai=3D"0"> <span= style=3D"color: #000000; text-decoration: none;"> Spring 2022 Product Cal= l Highlights </span> </a> </h2> </td> </tr> <tr> <td style=3D"color: #6c6c6c !important;= "> <p style=3D"margin-top: 0; margin-b= ottom: 0 !important; font-size: 0.9em; color: #6c6c6c !important; line-heig= ht: 1.5em;"> <span style=3D"color: #6c6c6c;"= > See the 23 products selected= that embody the functionality, beauty, and sustainability needed to help= create better spaces for clients, communities,… </span> <a href=3D"http://click1.e.hw-commercialdesign.com/scmzsvwpbrktlkcvtcfkvtwk= kwtkrlczgbmbhgsbrvbbjc_rgnknjjlcvpcvgtcrnrjj.html" xt=3D"SPCLICK" name=3D"n= nn33" style=3D"display: inline-block !important; color: #00aeed !important;= text-decoration: none !important;" class=3D"moreLink" data-cms-ai=3D"0">= <span class=3D"moreLink" style=3D"display: inl= ine-block; color: #00aeed; text-decoration: none; text-transform: uppercase= ;"> Read More </span> </a> </p> </td> </tr> </tbody> </table> </td> </tr> </tbody> </table> </td> </tr> <tr> <td height=3D"18"> </td> </tr> <tr> <td width=3D"100%" colspan=3D"3" style=3D"border-collapse: collapse; mso-table-lspace: 0pt; mso-tabl= e-rspace: 0pt;"> <table width=3D"100%" cellspacing=3D"0" cellpadding=3D"0"> <tbody> <tr> <td class=3D"mobileColToRow extra-padding" width=3D"300= " valign=3D"top" style=3D"padding-left: 0; width: 300px;"> <div class=3D"mobileThumbnail" style=3D"width: 300p= x; overflow: hidden;"> <a href=3D"http://click1.e.hw-commercialdesign.com/cglkjpvmtdlfqlgpfgrlpfvl= lvfldqgkstctzsjtdptthc_rgnknjjlcvpcvgtcrnrjj.html" xt=3D"SPCLICK" name=3D"n= nn34" style=3D"color:#000 !important; text-decoration: none !important;"=20= data-cms-ai=3D"0"><img src=3D"https://cdnassets.hw.net/dims4/GG/902db34/214= 7483647/thumbnail/300x200%3E/quality/90/?url=3Dhttps%3A%2F%2Fcdnassets.hw.n= et%2Fdf%2F20%2F2e4a7b3a4d1f868a1bb9abc2ca7a%2Fmassdesigngrouphero.jpg" widt= h=3D"300" height=3D"200" border=3D"0" alt=3D"2022 AIA Architecture Firm Awa= rd: MASS Design Group" data-size=3D"promo_300x200"></a> =20= </div> </td> <td style=3D"border-collapse: collapse; mso-table-lspac= e: 0pt; mso-table-rspace: 0pt;"> <table class=3D"img-spacer" width=3D"12" align=3D"c= enter" style=3D"width: 12px; height: 0;"> <tr> <td> </td> </tr> </table> </td> <td class=3D"mobileColToRow" width=3D"303" colspan=3D"1= " rowspan=3D"1" valign=3D"top" style=3D"clear: both; padding-left: 0; "> <table width=3D"100%"> <tbody> <tr> <td class=3D"eyebrow" style=3D"color:= #ed1f24; padding-bottom: 5px;"> <p style=3D"display: inline-block= !important; color: #ed1f24 !important; margin-top: 0; margin-bottom: 0 !im= portant; font-size: 0.7em; font-weight: bold; text-transform: uppercase;"> <span style=3D"display: inline-= block; color: #ed1f24;"> 2022 AIA Awards </span> </p> </td> </tr> <tr> <td style=3D"color: #000000 !important;= "> <h2 style=3D"display: inline-block= !important; color: #000000; margin-top: 0; margin-bottom: 0 !important;=20= font-size: 1.4em; font-weight: bold; line-height: 1.1em;"> <a href=3D"http://click1.e.hw-commercialdesign.com/ntrcrfgkqypnjptfnthpfngp= pgnpyjtcbqdqmbrqyfqqwp_rgnknjjlcvpcvgtcrnrjj.html" xt=3D"SPCLICK" name=3D"n= nn35" style=3D"color: #000000 !important; text-decoration: none !important;= " data-cms-ai=3D"0"> <span= style=3D"color: #000000; text-decoration: none;"> 2022 AIA Architecture= Firm Award: MASS Design Group </span> </a> </h2> </td> </tr> <tr> <td style=3D"color: #6c6c6c !important;= "> <p style=3D"margin-top: 0; margin-b= ottom: 0 !important; font-size: 0.9em; color: #6c6c6c !important; line-heig= ht: 1.5em;"> <span style=3D"color: #6c6c6c;"= > "It was always our hope to= create a place for people to build careers doing mission-based work, and= we are proud to be building the largest, most… </span> <a href=3D"http://click1.e.hw-commercialdesign.com/yfcpbqyvslgncgfqnfrgqnyg= gynglcfpwskstwbslqssmb_rgnknjjlcvpcvgtcrnrjj.html" xt=3D"SPCLICK" name=3D"n= nn36" style=3D"display: inline-block !important; color: #00aeed !important;= text-decoration: none !important;" class=3D"moreLink" data-cms-ai=3D"0">= <span class=3D"moreLink" style=3D"display: inl= ine-block; color: #00aeed; text-decoration: none; text-transform: uppercase= ;"> Read More </span> </a> </p> </td> </tr> </tbody> </table> </td> </tr> </tbody> </table> </td> </tr> <tr> <td height=3D"18"> </td> </tr> <tr> <td width=3D"600" valign=3D"top" align=3D"center" style=3D"padding-bottom: 20px; border-bottom: 3px solid #000;"></td= > </tr> <tr> <td height=3D"10"> </td> </tr><tr> <td style=3D"color: #000000 !important;"><h2 style=3D"displ= ay: inline-block !important; color: #000000; margin-top: 0; margin-bottom:= 0 !important; font-size: 1.0em; font-weight: bold; line-height: 1.1em;">= <span style=3D"color: #ed1f24; text-decoration: none;"> Upcoming Events:= </span></h2></td> </tr> <tr> <td height=3D"10"> </td> </tr> <tr> <td style=3D"color: #000000 !important;= "> <h2 style=3D"display: inline-block= !important; color: #000000; margin-top: 0; margin-bottom: 0 !important;=20= font-size: .9em; font-weight: bold; line-height: 1.1em;"> <a href=3D"http://click1.e.hw-commercialdesign.com/ibctnvpcyhdwzdbvwbkdvwpd= dpwdhzbtrymyqrnyhvyygz_rgnknjjlcvpcvgtcrnrjj.html" name=3D"nnn50" style=3D"= color: #000000 !important; text-decoration: none !important;" data-cms-ai= =3D"0"> <span style=3D"color= : #000000; text-decoration: none;"> Future Place by Builder<= /a> — Oct 3, 2022 - Oct 4, 2022 | Thompson Hotel, Dallas, TX=20 </span> </a> </h2> </td> </tr> =09=09=09=09 =09=09=09=09 <tr> <td style=3D"color: #6c6c6c !important;= "> <p style=3D"margin-top: 0; margin-b= ottom: 0 !important; font-size: 0.8em; color: #6c6c6c !important; line-heig= ht: 1.5em;"> <span style=3D"color: #6c6c6c;"= > Zonda=E2=80=99s Future Place= conference is dedicated to master planned communities and all the elements= =E2=80=93from finance to management, and from design to development=E2=80= =93 that make them successful. </span> <h2 style=3D"display:= inline-block !important; color: #000000; margin-top: 0; margin-bottom: 0= !important; font-size: 0.8em; font-weight: bold; line-height: 1.1em;"><a= href=3D"http://click1.e.hw-commercialdesign.com/smjzsvwpbrktlkcvtcfkvtwkkw= tkrlczgbmbhgsbrvbbjp_rgnknjjlcvpcvgtcrnrjj.html" name=3D"nnn51" style=3D"co= lor: #000000 !important; text-decoration: none !important;" data-cms-ai=3D"= 0"> <span class=3D"moreLink" style=3D"display: inl= ine-block; color: #00aeed; text-decoration: none; text-transform: uppercase= ;">Register Now</span> </a></h2></td> </tr> =20 <tr> <td height=3D"18"> </td> </tr> =20 =09=09=09=09=09=09 <tr> <td style=3D"color: #000000 !important;= "> <h2 style=3D"display: inline-block= !important; color: #000000; margin-top: 0; margin-bottom: 0 !important;=20= font-size: .9em; font-weight: bold; line-height: 1.1em;"> <a href=3D"http://click1.e.hw-commercialdesign.com/cjdkjpvmtdlfqlgpfgrlpfvl= lvfldqgkstctzsjtdpttth_rgnknjjlcvpcvgtcrnrjj.html" name=3D"nnn52" style=3D"= color: #000000 !important; text-decoration: none !important;" data-cms-ai= =3D"0"> <span style=3D"color= : #000000; text-decoration: none;"> Architect Live</a> &mdas= h; Nov 7, 2022 - Nov 9, 2022 | The Watergate Hotel, Washington, DC=20 </span> </a> </h2> </td> </tr> =09=09=09=09 =09=09=09=09 <tr> <td style=3D"color: #6c6c6c !important;= "> <p style=3D"margin-top: 0; margin-b= ottom: 0 !important; font-size: 0.8em; color: #6c6c6c !important; line-heig= ht: 1.5em;"> <span style=3D"color: #6c6c6c;"= > Explore innovative solutions= to some of today's pressing issues, such as the Covid-19 pandemic, glo= bal warming, and other social concerns. Join us November 7-9, 2022 in Washi= ngton, DC, to explore the… </span> <h2 style=3D"display:= inline-block !important; color: #000000; margin-top: 0; margin-bottom: 0= !important; font-size: 0.8em; font-weight: bold; line-height: 1.1em;"><a= href=3D"http://click1.e.hw-commercialdesign.com/qpsjpsydmwfthfvstvqfstyffy= tfwhvjcmgmrcpmwsmmmm_rgnknjjlcvpcvgtcrnrjj.html" name=3D"nnn53" style=3D"co= lor: #000000 !important; text-decoration: none !important;" data-cms-ai=3D"= 0"> <span class=3D"moreLink" style=3D"display: inl= ine-block; color: #00aeed; text-decoration: none; text-transform: uppercase= ;">Register Now</span> </a></h2></td> </tr> =20 =09=09=09=09=09=09 =09=09=09=09=09 =20 =09=09=09=09=09=09=09 =09=09=09=09=09=09<tr> <td width=3D"600" valign=3D"top" align=3D"center" style=3D"padding-bottom: 20px; border-bottom: 3px solid #000;"></td= > </tr> </tr> =20 </tr> =20 =20 =09=09=09=09=09=09=09 =09=09=09=09=09 =20 =09=09=09=09=09 =20 =09=09=09=09=09=09=09 =09=09=09=09=09=09=09 </tr> =20 <tr> <td class=3D"mobileSpecialLinks" width=3D"600" style=3D"padding-top:=20= 10px; padding-bottom: 20px;" valign=3D"top"> <ul style=3D"margin-top: 0; margin-right: 0; margin-bottom: 0; marg= in-left: 0; padding-top: 0; padding-right: 0; padding-bottom: 0; padding-le= ft: 0; list-style-type: none;"> =20 =20 <span class=3D"" style=3D"margin-left: 0;"> <a href=3D"http://click1.e.hw-commercialdesign.com/pcyrcjwvhqlbdlyjbytljbwl= lwblqdyrghmhkgchqjhhhq_rgnknjjlcvpcvgtcrnrjj.html" name=3D"nnn56" style=3D"= color: #ed1f24 !important; text-decoration: none !important;" class=3D"spe= cial-link" target=3D"_blank" data-cms-ai=3D"0"> <span=20= class=3D"special-link" style=3D"color: #ed1f24 !important; font-size:= 1.0em !important;"> Advertise </span> <br /> =09=09=09=09</a> =20 <span class=3D"" style=3D"margin-left: 0;"> <a href=3D"http://click1.e.hw-commercialdesign.com/bcgscfvzplqybqjfyjkqfyvq= qvyqlbjsnpgpmncplfpppf_rgnknjjlcvpcvgtcrnrjj.html" name=3D"nnn57" style=3D"= color: #ed1f24 !important; text-decoration: none !important;" class=3D"spe= cial-link" target=3D"_blank" data-cms-ai=3D"0"> <span=20= class=3D"special-link" style=3D"color: #ed1f24 !important; font-size:= 1.0em !important;"> Contact Us </span> </a> =20 =20 </td> </tr> <tr> =20 <table align=3D"center" width=3D"100%" border=3D"0" cellspacing=3D"= 0" cellpadding=3D"0"> <tr> <td> <p style=3D"text-align: center; margin-top: 0; margin-b= ottom: 5px !important; font-size: 1.25em; font-weight: bold; font-style:=20= italic;"> Follow Us </p> </td> </tr> <tr> <td style=3D"text-align: center; padding-left: 5px; padding= -right: 5px;"> <span style=3D"display: inline-block;"> <a name=3D"" style=3D"text-decoration: none;"= href=3D"http://click1.e.hw-commercialdesign.com/zwlgwpvfrmlkdlbpkbjlpkvllv= klmdbgcrsrqcwrmprrrb_rgnknjjlcvpcvgtcrnrjj.html" data-cms-ai=3D"0"> <img src=3D"https://cdnassets.hw.net/91/86/377e5fc44ee487474f8ce468e54e/twi= tter-social-icon-circle-resize.png" width=3D"35" height=3D"35" border=3D"0"= > </a> </span> <span> </span> <span style=3D"display: inline-block;"> <a name=3D"" style=3D"text-decoration: none;"= href=3D"http://click1.e.hw-commercialdesign.com/fggcghtydsnwrnbhwbznhwtnnt= wnsrbcpdjdlpgdshdddj_rgnknjjlcvpcvgtcrnrjj.html" data-cms-ai=3D"0"> <img src=3D"https://cdnassets.hw.net/51/b1/8422958f420fa89dec46e141ef33/fac= ebook-resize.png" width=3D"35" height=3D"35" border=3D"0"> =20= </a> </span> <span> </span> <span style=3D"display: inline-block;"> <a name=3D"" style=3D"text-decoration: none;"= href=3D"http://click1.e.hw-commercialdesign.com/pcdrcjwvhqlbdlyjbytljbwllw= blqdyrghmhkgchqjhhhl_rgnknjjlcvpcvgtcrnrjj.html" data-cms-ai=3D"0"> <img src=3D"https://cdnassets.hw.net/39/2f/1a3453ae432b833ad88dee73260d/lin= kedin-resize.png" width=3D"35" height=3D"35" border=3D"0"> =20= </a> </span> <span> </span> <span style=3D"display: inline-block;"> <a name=3D"" style=3D"text-decoration: none;"= href=3D"http://click1.e.hw-commercialdesign.com/wnjtnvkjdlsbzswvbwqsvbkssk= bslzwthdgdmhndlvdddn_rgnknjjlcvpcvgtcrnrjj.html" data-cms-ai=3D"0"> <img src=3D"https://cdnassets.hw.net/dd/11/e9739a9547fca36c636a7fba9279/ins= tagram-resize.png" width=3D"35" height=3D"35" border=3D"0"> =20= </a> </span> <span> </span> <span style=3D"display: inline-block;"> <a name=3D"" style=3D"text-decoration: none;"= href=3D"http://click1.e.hw-commercialdesign.com/frqcghtydsnwrnbhwbznhwtnnt= wnsrbcpdjdlpgdshdddr_rgnknjjlcvpcvgtcrnrjj.html" data-cms-ai=3D"0"> <img src=3D"https://cdnassets.hw.net/f3/05/5205782847ab99e767d07c999f52/pin= terest-resize.png" width=3D"35" height=3D"35" border=3D"0"> =20= </a> </span> =20 </td> </tr> </table> </td> </tr> <tr> <td width=3D"600" style=3D"padding-top: 15px; text-align: center; clear= : both;"> =20 <span style=3D"padding-bottom: 10px; font-family: Arial, Helvet= ica, sans-serif; font-size: 1.0em;"> <a href=3D"http://click1.e.hw-commercialdesign.com/bbpscfvzplqybqjfyjkqfyvq= qvyqlbjsnpgpmncplfpppz_rgnknjjlcvpcvgtcrnrjj.html" name=3D"nnn64" style=3D"= text-decoration: underline !important; color: #00aeed !important;" target= =3D"_blank" data-cms-ai=3D"0">AIA</a> =20 </span> </td> </tr> <tr> <td style=3D"height: 5px; line-height: 0; overflow: hidden; clear: both= ;"> =20 </td> </tr> <tr> <td width=3D"615" style=3D"padding-top: 10px; padding-bottom: 10px; tex= t-align: center; clear: both;"> <p style=3D"margin-top: 0; margin-botto= m:10px; font-size: 0.6em; color: #777 !important;">=20 To make sure you continue to receive our e-mails in your inbox (not in your= bulk or junk folders), please add architectnewswire@e.hw-commercialdesign.= com to your address book or safe sender list. </p> =20 =20 <p style=3D"margin-top: 0; margin-bottom:10px;= font-size: 0.6em; color: #777 !important;"> <a href=3D"http://click1.e.hw-commercialdesign.= com/rjnhtnylcrvpwvknpkfvnpyvvypvrwkhscgcbstcrnccrj_rgnknjjlcvpcvgtcrnrjj.ht= ml?a=3Delvis%40ebaarchitects.org" style=3D"color:#00aeef !important; text-d= ecoration: none !important;" data-cms-ai=3D"0">Click Here</a> to unsubscrib= e from ARCHITECT Newswire.</p> <p style=3D"margin-top: 0; margin-bottom:10px; font-size: 0.6em; color: #77= 7 !important;"> =20 =20 =09=09 =20 =20 =09=09 <p style=3D"margin-top: 0; margin-bottom:0; font-= size: 0.6em; color: #777 !important;">=C2=A9 Zonda Media, a Delaware corpor= ation. All Rights Reserved. Republication or re-dissemination of this newsl= etter's content is expressly prohibited without the written permission of= <a href=3D"http://click1.e.hw-commercialdesign.com/abyvtdrlmkpnspydnyzpdnr= pprnpksyvcmhmgctmkdmmkm_rgnknjjlcvpcvgtcrnrjj.html">Zonda Media, a Delaware= corporation.</a> </p><p style=3D"margin-top: 0; margin-bottom:0; font-size= : 0.6em; color: #777 !important;"> Zonda Media, a Delaware corporation | 1152 15th St. NW | Suite 850 | Washin= gton, DC 20005-5811</p> =09=09=09=09=09=09 </td> </tr> </table> </td> </tr> </table> <style type=3D"text/css"> /* Forces Outlook.com to display emails at full width */ .ExternalClass, .ExternalClass p, .ExternalClass span, .ExternalClass= font, .ExternalClass td, .ExternalClass div { line-height: 100%; } .ReadMsgBody { width: 100%; } .ExternalClass { width: 100%; line-height: 100%; } .ExternalClass p { margin-bottom: 0 !important; } /* Override AOL defaults */ body {font-family:Helvetica, Arial, sans-serif;font-size:12pt;margin:= 0;} th {font-size:12pt;} td {color: #6c6c6c;} td.eyebrow p a= [href]= { color: #ed1f24 !important; } /*Yahoo adds span.yshortcuts inside all links*/ a:link, span.yshortcuts { color: #000; /* Link color must be set inline for Gmail*/ background-color: none; border: none; text-decoration: none; } /* Overrides Outlook.com Contextual Highlighting */ span { color: #6c6c6c; border-bottom-width: 0; border-bottom-style: none; } p a:link, p span.yshortcuts { text-decoration: underline; } p a:active, p a:visited, p span.yshortcuts:active { text-decoration: underline; } a:active, a:visited, span.yshortcuts:active { color: #000; background-color: none; border: none; text-decoration: none; } a:hover, span.yshortcuts:hover, span.yshortcuts:focus { text-decoration: underline; } a.special-link, span.special-link { color: #f01e27 !important; text-decoration: none !important; } a.moreLink, span.moreLink, p a= [href]= { color: #00aeed !important; text-decoration: none !important; } h1 { color: #00aeed !important; text-decoration: none !important; } h1, h2, h3, h4, h5, h6, p, span { font-family: Arial, Helvetica, sans-serif; } h2, h4, h5 { color: #000 !important; /* Override Hotmail and Yahoo head tag colo= rs - Must also be set inline */ } h3 { color: #fff !important; } h6 { color: #777 !important; } .quote { color: #00adef !important; } p { margin-bottom: 0 !important; } .footertext { color: #777 !important; } table { border-collapse: collapse; } .MsoNormal { padding-bottom: 0 } /* =3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D= =3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D= =3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D= =3D=3D Mobile =3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D= =3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D= =3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D= =3D=3D */ table= [class=3D"mobileWrapper"]= { width: 650px !important; } table= [class=3D"mobileContent"]= { width: 615px !important; background-color: #ffffff !important; } table= [class=3D"mobileContent"]= td= [class=3D"50-50"]= > table { /*width: 300px !important;*/ max-width: 100% !important; } /*table= [class=3D"mobileContent"]= td= [class=3D"50-50"]= table= [align=3D"left"]= td{ padding-right: 12px !important; }*/ table.mobileContent td.mobileLogo { display: block !important; } table.mobileContent tr.mobileMobileLogo { display: none !important; text-align: left; } table.mobileContent td.mobileSocial img { margin: 0 !important; } table.mobileContent td.mobileSocial td { display: inline-block !important; width: auto !important; } table.mobileContent td.mobileAdwrapper img { border-style: none !important; } table.mobileContent td.extra-padding { padding-top: 5px !important; padding-bottom: 5px !important; } table.mobileContent td.extra-padding-bottom{ padding-bottom:18px !important; } @media only screen and (max-width: 614px) { table= [class=3D"mobileWrapper"]= { display: block !important; width: 350px !important; height: auto !important; padding: 0 15px !important } table= [class=3D"mobileContent"]= , table= [class=3D"mobileContent"]= table, table= [class=3D"mobileContent"]= thead, table= [class=3D"mobileContent"]= tbody, table= [class=3D"mobileContent"]= tfoot, table= [class=3D"mobileContent"]= th, table= [class=3D"mobileContent"]= td, table= [class=3D"mobileContent"]= tr, table= [class=3D"mobileContent"]= div.mobileThumbnail { display: block !important; width: 100% !important; height: auto !important; } table= [class=3D"mobileContent"]= td= [class=3D"50-50"]= > table{ width: 100% !important; float: none !important; clear: both !important; margin: 0 auto !important; } table= [class=3D"mobileContent"]= table= [class=3D"img-spacer"]= { display: none !important; } table= [class=3D"mobileContent"]= td= [class=3D"50-50"]= > table= [class=3D"spacer"]= { width: 100% !important; height: 10px !important; } table= [class=3D"mobileContent"]= td= [class=3D"50-50"]= > table td= [class=3D"mobileAdwrapper"]= { text-align: center !important; } table= [class=3D"mobileContent"]= td= [class=3D"50-50"]= table= [align=3D"left"]= td{ padding-right: 0 !important; } table= [class=3D"mobileContent"]= h3 { min-height: 12px !important; height: auto !important; width: 100% !important; } table= [class=3D"mobileContent"]= .mobileLogo { height: auto; } table= [class=3D"mobileContent"]= td.mobileAdwrapper { padding-left: 0 !important; text-align: center !important; } table= [class=3D"mobileContent"]= div.mobileThumbnail { display: block !important; width: 300px !important; max-height: 200px !important; height: auto !important; overflow: hidden !important; margin: 0 auto; } table= [class=3D"mobileContent"]= div.mobileThumbnail img { width: 300px !important; height: auto !important; } table= [class=3D"mobileContent"]= .mobileLogoImg { width: 300px !important; height: auto !important; } table= [class=3D"mobileContent"]= .mobileLeaderboardAd { padding-left: 0 !important; padding-right: 0 !important; } table= [class=3D"mobileContent"]= .mobileLeaderboardAd div { width: 100% !important; } table= [class=3D"mobileContent"]= .mobileLeaderboardAd img { width: 100% !important; height: auto !important; } table= [class=3D"mobileContent"]= .colSeparator { display: none; } table= [class=3D"mobileContent"]= .mobileDate { border-top: none !important; height: 35px; } table= [class=3D"mobileContent"]= .mobileSpecialLinks td { padding-top: 0 !important; padding-bottom: 20px !important; } table= [class=3D"mobileContent"]= .mobileSpecialLinks ul { font-size: 0; text-align: center; } table= [class=3D"mobileContent"]= .mobileSpecialLinks li { /*padding-right: 25px;*/ font-size: 15px; display: inline-block; } table= [class=3D"mobileContent"]= .mobileSpecialLinks li.mobileFirstChild { /*padding-right: 0px;*/ float: left; } table= [class=3D"mobileContent"]= .mobileSpecialLinks li.mobileLastChild { /*padding-right: 0px;*/ float: right; } table= [class=3D"mobileContent"]= .mobileSpecialLinks li.mobileArrow { background-image: url('http://images.hanleywood.com/newsletters= /arrow-right.png'); width: 14px; height: 14px; float: left; margin-right: 2px; } table= [class=3D"mobileContent"]= .mobileSpecialLinks li.mobileArrow img { display: none; } table= [class=3D"mobileContent"]= .mobileMagazine { float: left; width: 145px; padding-right: 10px; border-bottom: none !important; } table= [class=3D"mobileContent"]= .mobileMagazine div { border-bottom: none !important; } table= [class=3D"mobileContent"]= .mobileMagImg, table= [class=3D"mobileContent"]= .mobileMagImg img { width: 145px !important; height: auto !important; } table= [class=3D"mobileContent"]= .mobilePublicationLinks { float: left; width: 145px; } table= [class=3D"mobileContent"]= .mobilePublicationLinks + tr { clear: both; } table= [class=3D"mobileContent"]= .mobileColToRow { margin-bottom: 10px; } table= [class=3D"mobileContent"]= .mobileSocialIcons { width: 100% border-top: 2px solid #000; height: 34px; padding: 2px 0 !important; } table= [class=3D"mobileContent"]= td.mobileSocial { padding-bottom: 5px; } /* mobile hacks for the current issue before footer */ table= [class=3D"mobileContent"]= tr.mobileMobileLogo td > div { width: 100% !important; overflow: auto !important; height: auto !important; line-height: normal !important; } table= [class=3D"mobileContent"]= tr.mobileMobileLogo { display: block !important; } table= [class=3D"mobileContent"]= tr.mobileMobileLogo td > div { display: block !important; height: auto !important; width: auto !important; } table= [class=3D"mobileContent"]= .utilityLinks a.special-link span.special-link { font-size: 0.6em !important; } table= [class=3D"mobileContent"]= td.mobileSocial img { display: inline-block !important; } table= [class=3D"mobileContent"]= td.extra-padding { padding-top: 0px !important; padding-bottom: 0px !important; } table= [class=3D"mobileContent"]= .zero-height { height: 0px !important; } table= [class=3D"mobileContent"]= div.mobileImage { width: 300px !important; overflow: hidden !important; height: 200px !important; } table= [class=3D"mobileContent"]= div.mobileImage img { width: 300px !important; height: auto !important; } table= [class=3D"mobileContent"]= span#mobileChart { display: block; width: 300px !important; height: 200px !important; } table= [class=3D"mobileContent"]= .colSeparator { display: none; } table= [class=3D"mobileContent"]= .mobileLeftCol { display: inline-block; } table= [class=3D"mobileContent"]= .mobileRightCol { width: 80px !important; float: right; } table= [class=3D"mobileContent"]= .mobileLogo td { display: table-cell; } table= [class=3D"mobileContent"]= .mobileHeader img { max-width: 300px; height: auto; } table= [class=3D"mobileContent"]= .mobileHeader, table= [class=3D"mobileContent"]= .mobileHeader table, table= [class=3D"mobileContent"]= .mobileHeader td { height: auto !important; } table= [class=3D"mobileContent"]= .mobileHeader table { margin-top: 5px !important; margin-bottom: 5px !important; } table= [class=3D"mobileContent"]= .mobileHeaderAd, table= [class=3D"mobileContent"]= .mobileHeaderAd table, table= [class=3D"mobileContent"]= .mobileHeaderAd tbody, table= [class=3D"mobileContent"]= .mobileHeaderAd td, table= [class=3D"mobileContent"]= .mobileHeaderAd tr, table= [class=3D"mobileContent"]= .mobileHeaderAd h6 { width: 80px !important; } table= [class=3D"mobileContent"]= .mobileHeaderAd h6 { font-size: .55em !important; -webkit-text-size-adjust: none; -moz-text-size-adjust: none; -ms-text-size-adjust: none; } table= [class=3D"mobileContent"]= .mobileHeaderAd { ] border: none !important; position: absolute; top: -40px; } table= [class=3D"mobileContent"]= .mobileHeaderAd img { max-width: 80px; height: auto; } table= [class=3D"mobileContent"]= .mobileFooterAd img { width: 300px !important; height: auto !important; } td= [id=3D"mobileHideMagazineIssue"]= { display: none !important;=20 } table= [id=3D"mobileRelative"]= { position: relative !important; top: 50px !important; } } </style> <img src=3D"https://c297db.efeedbacktrk.com/rtnhtnylcrvpwvknpkfvnpyvvypvrwk= hscgcbstcrncjvt_rgnknjjlcvpcvgtcrnrjj.gif" width=3D"0" height=3D"0" alt=3D"= "> <span style=3D"display: none;"><a href=3D'http://click1.e.hw-commerciald= esign.com/xgrnjhkcdvbtsbphtplbhtkbbktbvspnydrdqyjdvhddvv_rgnknjjlcvpcvgtcrn= rjj.html?a=3DA73B9126-8643-4D63-B66B-6284AE151CE7&b=3Dbbfjfddzpq'>Link</a><= /span> </body> </html>