OwlCyberSecurity - MANAGER
Edit File: 1662743182.M300533P1222647.server237.web-hosting.com,S=117056,W=120391:2,
Return-Path: <bounce-umhgwyychfsnwnpmshffqpwcqyyszpwvchqf@communication.hanleywood.com> Delivered-To: elvis@ebaarchitects.org Received: from server237.web-hosting.com by server237.web-hosting.com with LMTP id QLbpEI5yG2P3pxIA7Ypugw (envelope-from <bounce-umhgwyychfsnwnpmshffqpwcqyyszpwvchqf@communication.hanleywood.com>) for <elvis@ebaarchitects.org>; Fri, 09 Sep 2022 13:06:22 -0400 Return-path: <bounce-umhgwyychfsnwnpmshffqpwcqyyszpwvchqf@communication.hanleywood.com> Envelope-to: elvis@ebaarchitects.org Delivery-date: Fri, 09 Sep 2022 13:06:22 -0400 Received: from mail4.communication.hanleywood.com ([96.46.128.145]:44506) by server237.web-hosting.com with esmtps (TLS1.2) tls TLS_ECDHE_RSA_WITH_AES_256_GCM_SHA384 (Exim 4.95) (envelope-from <bounce-umhgwyychfsnwnpmshffqpwcqyyszpwvchqf@communication.hanleywood.com>) id 1oWhSK-005Xww-0F for elvis@ebaarchitects.org; Fri, 09 Sep 2022 13:06:22 -0400 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; s=class; d=e.hw-commercialdesign.com; h=Date:From:Reply-To:To:Message-ID:Subject:MIME-Version:Content-Type: Content-Transfer-Encoding:List-Unsubscribe; i=architectnewswire@e.hw-commercialdesign.com; bh=G5S1Bx90MaLhfZrTZtJjgWkcfVNoTNRk+mghuYwz6lY=; b=oGk8DP6qphWoHJFIO6XLvq7T5XIpYB6Fa4VZsI1v9P7L46RFeLYh/NJgr6K6bZ9QPrYU64kUVI94 Sg1yTFKb4nqDjvoeDrKcaWCctF3d7OiYn5kzI1QTkWTViOQ6W+7XxpYFbTG7XTpE6wM0nHdCzOGT xd52Qzk5Fn16YgdJCUQ= DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; s=class; d=communication.hanleywood.com; h=Date:From:Reply-To:To:Message-ID:Subject:MIME-Version:Content-Type: Content-Transfer-Encoding:List-Unsubscribe; bh=G5S1Bx90MaLhfZrTZtJjgWkcfVNoTNRk+mghuYwz6lY=; b=iJG/iTJdNWezIjNKrhAGfSj//TkEgTAhYrumoFseAJqo8ktr3qNETS05WayXusKHsdcSRP8qeVba NvkgmAZNRs8FRBUsZUKBLJS3+7rkFIqfoWy9oFesRHAD2GWPJkVyG8z0G4EaiIQFjS/JUuAHdQ21 chh/+4fC6un0hDvFiRc= Received: by mail4.communication.hanleywood.com id h3dp5s2uaicn for <elvis@ebaarchitects.org>; Fri, 9 Sep 2022 12:05:34 -0500 (envelope-from <bounce-umhgwyychfsnwnpmshffqpwcqyyszpwvchqf@communication.hanleywood.com>) Date: Fri, 9 Sep 2022 12:05:34 -0500 (CDT) From: Architect Newswire <architectnewswire@e.hw-commercialdesign.com> Reply-To: Hanley Wood <updates@communication.hanleywood.com> To: friend <elvis@ebaarchitects.org> Message-ID: <2145734867.3980090.1662743134282@communication.hanleywood.com> Subject: Tree Thieves: Who Owns the Forest? MIME-Version: 1.0 Content-Type: text/html; charset=UTF-8 Content-Transfer-Encoding: quoted-printable X-HANW: qwndmgffsmnstmwmtpmmppdfvh jpsydmwfhfvsvqfsyffyfwhvjcmgmrcptvsnndmftgsgphtmffwpsdwnn mfwpvvwpgm List-Unsubscribe: <mailto:unsub-4300916-53578-A73B912686434D63B66B6284AE151CE7@communication.hanleywood.com> X-Spam-Status: No, score=0.4 X-Spam-Score: 4 X-Spam-Bar: / X-Ham-Report: Spam detection software, running on the system "server237.web-hosting.com", has NOT identified this incoming email as spam. The original message has been attached to this so you can view it or label similar future email. If you have any questions, see root\@localhost for details. Content preview: Architect Newswire Hope Around the World A Critic's Notebook Content analysis details: (0.4 points, 5.0 required) pts rule name description ---- ---------------------- -------------------------------------------------- 0.0 URIBL_BLOCKED ADMINISTRATOR NOTICE: The query to URIBL was blocked. See http://wiki.apache.org/spamassassin/DnsBlocklists#dnsbl-block for more information. [URIs: hw-commercialdesign.com] 0.2 HEADER_FROM_DIFFERENT_DOMAINS From and EnvelopeFrom 2nd level mail domains are different -0.0 SPF_PASS SPF: sender matches SPF record 0.1 URI_HEX URI: URI hostname has long hexadecimal sequence 0.0 HTML_MESSAGE BODY: HTML included in message 0.1 MIME_HTML_ONLY BODY: Message only has text/html MIME parts 0.0 HTML_IMAGE_RATIO_04 BODY: HTML has a low ratio of text to image area 0.1 DKIM_SIGNED Message has a DKIM or DK signature, not necessarily valid -0.1 DKIM_VALID_AU Message has a valid DKIM or DK signature from author's domain -0.1 DKIM_VALID Message has at least one valid DKIM or DK signature 0.0 T_KAM_HTML_FONT_INVALID Test for Invalidly Named or Formatted Colors in HTML -0.0 T_SCC_BODY_TEXT_LINE No description available. X-Spam-Flag: NO =20 <!DOCTYPE html PUBLIC "-//W3C//DTD XHTML 1.0 Strict//EN" "http://www.w3= =2Eorg/TR/xhtml1/DTD/xhtml1-strict.dtd"> <html xmlns=3D"http://www.w3.org/1999/xhtml" xmlns:v=3D"urn:schemas-microsoft-com:vml" xmlns:o=3D"urn:schemas-microsoft-com:office:office"> <head profile=3D"http://www.w3.org/2005/10/profile"> <title>Architect Newswire</title> <meta http-equiv=3D"content-type" content=3D"charset=3Dutf-8"/> <meta http-equiv=3D"content-language" content=3D"en-us"/> <meta name=3D"viewport" content=3D"width=3Ddevice-width, initial-scale= =3D1.0, maximum-scale=3D2.0, user-scalable=3Dyes"/> <style type=3D"text/css"> /* Forces Outlook.com to display emails at full width */ .ExternalClass, .ExternalClass p, .ExternalClass span, .ExternalClass= font, .ExternalClass td, .ExternalClass div { line-height: 100%; } .ReadMsgBody { width: 100%; } .ExternalClass { width: 100%; line-height: 100%; } .ExternalClass p { margin-bottom: 0 !important; } /* Override AOL defaults */ body {font-family:Helvetica, Arial, sans-serif;font-size:12pt;margin:= 0;} th {font-size:12pt;} td {color: #6c6c6c;} td.eyebrow p a= [href]= { color: #ed1f24 !important; } /*Yahoo adds span.yshortcuts inside all links*/ a:link, span.yshortcuts { color: #000; /* Link color must be set inline for Gmail*/ background-color: none; border: none; text-decoration: none; } /* Overrides Outlook.com Contextual Highlighting */ span { color: #6c6c6c; border-bottom-width: 0; border-bottom-style: none; } p a:link, p span.yshortcuts { text-decoration: underline; } p a:active, p a:visited, p span.yshortcuts:active { text-decoration: underline; } a:active, a:visited, span.yshortcuts:active { color: #000; background-color: none; border: none; text-decoration: none; } a:hover, span.yshortcuts:hover, span.yshortcuts:focus { text-decoration: underline; } a.special-link, span.special-link { color: #f01e27 !important; text-decoration: none !important; } a.moreLink, span.moreLink, p a= [href]= { color: #00aeed !important; text-decoration: none !important; } h1 { color: #00aeed !important; text-decoration: none !important; } h1, h2, h3, h4, h5, h6, p, span { font-family: Arial, Helvetica, sans-serif; } h2, h4, h5 { color: #000 !important; /* Override Hotmail and Yahoo head tag colo= rs - Must also be set inline */ } h3 { color: #fff !important; } h6 { color: #777 !important; } .quote { color: #00adef !important; } p { margin-bottom: 0 !important; } .footertext { color: #777 !important; } table { border-collapse: collapse; } .MsoNormal { padding-bottom: 0 } /* =3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D= =3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D= =3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D= =3D=3D Mobile =3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D= =3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D= =3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D= =3D=3D */ table= [class=3D"mobileWrapper"]= { width: 650px !important; } table= [class=3D"mobileContent"]= { width: 615px !important; background-color: #ffffff !important; } table= [class=3D"mobileContent"]= td= [class=3D"50-50"]= > table { /*width: 300px !important;*/ max-width: 100% !important; } /*table= [class=3D"mobileContent"]= td= [class=3D"50-50"]= table= [align=3D"left"]= td{ padding-right: 12px !important; }*/ table.mobileContent td.mobileLogo { display: block !important; } table.mobileContent tr.mobileMobileLogo { display: none !important; text-align: left; } table.mobileContent td.mobileSocial img { margin: 0 !important; } table.mobileContent td.mobileSocial td { display: inline-block !important; width: auto !important; } table.mobileContent td.mobileAdwrapper img { border-style: none !important; } table.mobileContent td.extra-padding { padding-top: 5px !important; padding-bottom: 5px !important; } table.mobileContent td.extra-padding-bottom{ padding-bottom:18px !important; } @media only screen and (max-width: 614px) { table= [class=3D"mobileWrapper"]= { display: block !important; width: 350px !important; height: auto !important; padding: 0 15px !important } table= [class=3D"mobileContent"]= , table= [class=3D"mobileContent"]= table, table= [class=3D"mobileContent"]= thead, table= [class=3D"mobileContent"]= tbody, table= [class=3D"mobileContent"]= tfoot, table= [class=3D"mobileContent"]= th, table= [class=3D"mobileContent"]= td, table= [class=3D"mobileContent"]= tr, table= [class=3D"mobileContent"]= div.mobileThumbnail { display: block !important; width: 100% !important; height: auto !important; } table= [class=3D"mobileContent"]= td= [class=3D"50-50"]= > table{ width: 100% !important; float: none !important; clear: both !important; margin: 0 auto !important; } table= [class=3D"mobileContent"]= table= [class=3D"img-spacer"]= { display: none !important; } table= [class=3D"mobileContent"]= td= [class=3D"50-50"]= > table= [class=3D"spacer"]= { width: 100% !important; height: 10px !important; } table= [class=3D"mobileContent"]= td= [class=3D"50-50"]= > table td= [class=3D"mobileAdwrapper"]= { text-align: center !important; } table= [class=3D"mobileContent"]= td= [class=3D"50-50"]= table= [align=3D"left"]= td{ padding-right: 0 !important; } table= [class=3D"mobileContent"]= h3 { min-height: 12px !important; height: auto !important; width: 100% !important; } table= [class=3D"mobileContent"]= .mobileLogo { height: auto; } table= [class=3D"mobileContent"]= td.mobileAdwrapper { padding-left: 0 !important; text-align: center !important; } table= [class=3D"mobileContent"]= div.mobileThumbnail { display: block !important; width: 300px !important; max-height: 200px !important; height: auto !important; overflow: hidden !important; margin: 0 auto; } table= [class=3D"mobileContent"]= div.mobileThumbnail img { width: 300px !important; height: auto !important; } table= [class=3D"mobileContent"]= .mobileLogoImg { width: 300px !important; height: auto !important; } table= [class=3D"mobileContent"]= .mobileLeaderboardAd { padding-left: 0 !important; padding-right: 0 !important; } table= [class=3D"mobileContent"]= .mobileLeaderboardAd div { width: 100% !important; } table= [class=3D"mobileContent"]= .mobileLeaderboardAd img { width: 100% !important; height: auto !important; } table= [class=3D"mobileContent"]= .colSeparator { display: none; } table= [class=3D"mobileContent"]= .mobileDate { border-top: none !important; height: 35px; } table= [class=3D"mobileContent"]= .mobileSpecialLinks td { padding-top: 0 !important; padding-bottom: 20px !important; } table= [class=3D"mobileContent"]= .mobileSpecialLinks ul { font-size: 0; text-align: center; } table= [class=3D"mobileContent"]= .mobileSpecialLinks li { /*padding-right: 25px;*/ font-size: 15px; display: inline-block; } table= [class=3D"mobileContent"]= .mobileSpecialLinks li.mobileFirstChild { /*padding-right: 0px;*/ float: left; } table= [class=3D"mobileContent"]= .mobileSpecialLinks li.mobileLastChild { /*padding-right: 0px;*/ float: right; } table= [class=3D"mobileContent"]= .mobileSpecialLinks li.mobileArrow { background-image: url('http://images.hanleywood.com/newsletters= /arrow-right.png'); width: 14px; height: 14px; float: left; margin-right: 2px; } table= [class=3D"mobileContent"]= .mobileSpecialLinks li.mobileArrow img { display: none; } table= [class=3D"mobileContent"]= .mobileMagazine { float: left; width: 145px; padding-right: 10px; border-bottom: none !important; } table= [class=3D"mobileContent"]= .mobileMagazine div { border-bottom: none !important; } table= [class=3D"mobileContent"]= .mobileMagImg, table= [class=3D"mobileContent"]= .mobileMagImg img { width: 145px !important; height: auto !important; } table= [class=3D"mobileContent"]= .mobilePublicationLinks { float: left; width: 145px; } table= [class=3D"mobileContent"]= .mobilePublicationLinks + tr { clear: both; } table= [class=3D"mobileContent"]= .mobileColToRow { margin-bottom: 10px; } table= [class=3D"mobileContent"]= .mobileSocialIcons { width: 100% border-top: 2px solid #000; height: 34px; padding: 2px 0 !important; } table= [class=3D"mobileContent"]= td.mobileSocial { padding-bottom: 5px; } /* mobile hacks for the current issue before footer */ table= [class=3D"mobileContent"]= tr.mobileMobileLogo td > div { width: 100% !important; overflow: auto !important; height: auto !important; line-height: normal !important; } table= [class=3D"mobileContent"]= tr.mobileMobileLogo { display: block !important; } table= [class=3D"mobileContent"]= tr.mobileMobileLogo td > div { display: block !important; height: auto !important; width: auto !important; } table= [class=3D"mobileContent"]= .utilityLinks a.special-link span.special-link { font-size: 0.6em !important; } table= [class=3D"mobileContent"]= td.mobileSocial img { display: inline-block !important; } table= [class=3D"mobileContent"]= td.extra-padding { padding-top: 0px !important; padding-bottom: 0px !important; } table= [class=3D"mobileContent"]= .zero-height { height: 0px !important; } table= [class=3D"mobileContent"]= div.mobileImage { width: 300px !important; overflow: hidden !important; height: 200px !important; } table= [class=3D"mobileContent"]= div.mobileImage img { width: 300px !important; height: auto !important; } table= [class=3D"mobileContent"]= span#mobileChart { display: block; width: 300px !important; height: 200px !important; } table= [class=3D"mobileContent"]= .colSeparator { display: none; } table= [class=3D"mobileContent"]= .mobileLeftCol { display: inline-block; } table= [class=3D"mobileContent"]= .mobileRightCol { width: 80px !important; float: right; } table= [class=3D"mobileContent"]= .mobileLogo td { display: table-cell; } table= [class=3D"mobileContent"]= .mobileHeader img { max-width: 300px; height: auto; } table= [class=3D"mobileContent"]= .mobileHeader, table= [class=3D"mobileContent"]= .mobileHeader table, table= [class=3D"mobileContent"]= .mobileHeader td { height: auto !important; } table= [class=3D"mobileContent"]= .mobileHeader table { margin-top: 5px !important; margin-bottom: 5px !important; } table= [class=3D"mobileContent"]= .mobileHeaderAd, table= [class=3D"mobileContent"]= .mobileHeaderAd table, table= [class=3D"mobileContent"]= .mobileHeaderAd tbody, table= [class=3D"mobileContent"]= .mobileHeaderAd td, table= [class=3D"mobileContent"]= .mobileHeaderAd tr, table= [class=3D"mobileContent"]= .mobileHeaderAd h6 { width: 80px !important; } table= [class=3D"mobileContent"]= .mobileHeaderAd h6 { font-size: .55em !important; -webkit-text-size-adjust: none; -moz-text-size-adjust: none; -ms-text-size-adjust: none; } table= [class=3D"mobileContent"]= .mobileHeaderAd { ] border: none !important; position: absolute; top: -40px; } table= [class=3D"mobileContent"]= .mobileHeaderAd img { max-width: 80px; height: auto; } table= [class=3D"mobileContent"]= .mobileFooterAd img { width: 300px !important; height: auto !important; } td= [id=3D"mobileHideMagazineIssue"]= { display: none !important;=20 } table= [id=3D"mobileRelative"]= { position: relative !important; top: 50px !important; } } </style> </head> <body style=3D"background-color: #f2f3f5; color: #6c6c6c; font-size: 12pt;= margin-top: 0; margin-right: 0; margin-bottom: 0; margin-left: 0; padding-= top: 0; padding-right: 0; padding-bottom: 0; padding-left: 0;"> <table align=3D"center" width=3D"650" border=3D"0" cellspacing=3D"0" cellpa= dding=3D"0" class=3D"mobileWrapper" style=3D"width: 650px; margin-top: 0; margin-right: auto; margin-bot= tom: 0; margin-left: auto; padding: 0; font-family: Arial, Helvetica, sans-= serif; color: #6c6c6c; background-color: #fff;"> <tr> <td width=3D"615" style=3D"padding: 0; margin: 0; width: 615px;"> <table class=3D"mobileContent" id=3D"" width=3D"615" border=3D"= 0" cellspacing=3D"0" cellpadding=3D"0" align=3D"center" style=3D"margin-top: 0; margin-right: auto; margin-botto= m: 0; margin-left: auto; padding-top: 0; padding-bottom: 0;"> =20 <tr> <td style=3D"color: #6c6c6c !important;"> <p style=3D"margin-top: 0; margin-bottom: 20px !imp= ortant; font-size: 0.85em; color: #6c6c6c !important; "> <strong> <span style=3D"color:#6c6c6c !important;"> Hope Around the World</span> </strong> </p> </td> </tr> <tr> <td align=3D"center" class=3D"mobileLeaderboardAd" width=3D"600" style=3D"padding-right: 6px; padding-top: 17px; padding-bottom: 3px= ; padding-left: 6px; text-align: center;"> <div style=3D"width: 600px; margin-right: auto; margin-left: auto;"= > <!--POWERINBOX 600x90--> <div class=3D"pi_17437 powerinbox"> <!-- domain: rs-stripe.architectmagazine.com --> <!--= [if (gte mso 9)|(IE)]= ><table align=3D"center" cellpadding=3D"0" cellspacing=3D"0" width=3D"600">= <tr><td><!= [endif]= --> <table width=3D"100%" border=3D"0" cellspacing=3D"0" cellpadding=3D"0"=20= style=3D"width: 100%; max-width: 600px;"> <tbody> <tr> <td width=3D"100%"> <a href=3D"http://click1.e.hw-commercialdesign.com/lmdfwgshmknrqn= dgrdpngrsnnsrnkqdflmjmclwmkhjkwj_qvvvsnndmftmffwpsdwnn.html?a=3Delvis%40eba= architects.org&b=3D53578" style=3D"border-style: none; outline: none; text-= decoration: none;" target=3D"_blank" ref=3D"nofollow"><img alt=3D"" height= =3D"auto" src=3D"https://rs-stripe.architectmagazine.com/stripe/image?cs_em= ail=3Delvis@ebaarchitects.org&cs_sendid=3D53578&cs_esp=3Dpostup&cs_offset= =3D0&cs_stripeid=3D17437&dfp_nl_send_date=3D09/08/2022" style=3D"width: 100= %; max-width: 600px;display: block; border: 0; height: auto; line-height:= 100%; outline: none; text-decoration: none;" width=3D"600"></a> </td> </tr> </tbody> </table> <!--= [if (gte mso 9)|(IE)]= ></td></tr></table><!= [endif]= --> </div> <!--POWERINBOX 600x90--> </div> </td> </tr> <tr> <td width=3D"100%" valign=3D"top" align=3D"center" height=3D"30" style= =3D"height: 30px;"> =20 </td> </tr> <tr> <td width=3D"100%" valign=3D"top" align=3D"center" style=3D"padding-bottom: 20px; border-bottom: 5px solid #000;"> <a href=3D"http://click1.e.hw-commercialdesign.com/phmrcjwvhqlbdlyjbytl= jbwllwblqdyrghmhkgchqvmqcl_qvvvsnndmftmffwpsdwnn.html" name=3D"" style=3D"c= olor: #000; text-decoration: none;" data-cms-ai=3D"0"> <img src=3D"https://cdnassets.hw.net/5b/f2/0fcd74f94927883a36c1c3aa7f4c/arc= hitect-newsletter-config.png" width=3D"341" height=3D"57" border=3D"0" vspa= ce=3D"8" alt=3D"Architect Newswire" style=3D"vertical-align: bottom; max-wi= dth: 456px; height: auto; margin-top: 0px; margin-bottom: 0" class=3D"mobil= eLogoImg"/> </a> </td> </tr> <tr> <td height=3D"18"> </td> </tr> <tr> <td width=3D"100%" valign=3D"top" class=3D"extra-paddin= g"> <table width=3D"100%" border=3D"0" cellspacing=3D"0= " cellpadding=3D"0"> <tr> <td width=3D"100%" colspan=3D"3" style=3D"border-collapse: collapse; mso-table-lspace: 0pt; mso-tabl= e-rspace: 0pt;"> <table width=3D"100%" cellspacing=3D"0" cellpadding=3D"0"> <tbody> <tr> <td class=3D"mobileColToRow extra-padding" width=3D"300= " valign=3D"top" style=3D"padding-left: 0; width: 300px;"> <div class=3D"mobileThumbnail" style=3D"width: 300p= x; overflow: hidden;"> <a href=3D"http://click1.e.hw-commercialdesign.com/wdstnvkjdlsbzswvbwqsvbks= skbslzwthdgdmhndljglnn_qvvvsnndmftmffwpsdwnn.html" xt=3D"SPCLICK" name=3D"n= nn1" style=3D"color:#000 !important; text-decoration: none !important;" dat= a-cms-ai=3D"0"><img src=3D"https://cdnassets.hw.net/dims4/GG/3b8da46/214748= 3647/thumbnail/300x200%3E/quality/90/?url=3Dhttps%3A%2F%2Fcdnassets.hw.net%= 2F71%2F64%2F4ad8b5c94c37962704ffabb31cda%2Fworldaround-hero.jpg" width=3D"3= 00" height=3D"200" border=3D"0" alt=3D"Hope Around the World" data-size=3D"= promo_300x200"></a> </div> </td> <td style=3D"border-collapse: collapse; mso-table-lspac= e: 0pt; mso-table-rspace: 0pt;"> <table class=3D"img-spacer" width=3D"12" align=3D"c= enter" style=3D"width: 12px; height: 0;"> <tr> <td> </td> </tr> </table> </td> <td class=3D"mobileColToRow" width=3D"303" colspan=3D"1= " rowspan=3D"1" valign=3D"top" style=3D"clear: both; padding-left: 0; "> <table width=3D"100%"> <tbody> <tr> <td class=3D"eyebrow" style=3D"color:= #ed1f24; padding-bottom: 5px;"> <p style=3D"display: inline-block= !important; color: #ed1f24 !important; margin-top: 0; margin-bottom: 0 !im= portant; font-size: 0.7em; font-weight: bold; text-transform: uppercase;"> <span style=3D"display: inline-= block; color: #ed1f24;"> A Critic's Notebook </span> </p> </td> </tr> <tr> <td style=3D"color: #000000 !important;= "> <h2 style=3D"display: inline-block= !important; color: #000000; margin-top: 0; margin-bottom: 0 !important;=20= font-size: 1.4em; font-weight: bold; line-height: 1.1em;"> <a href=3D"http://click1.e.hw-commercialdesign.com/wdntnvkjdlsbzswvbwqsvbks= skbslzwthdgdmhndljglnz_qvvvsnndmftmffwpsdwnn.html" xt=3D"SPCLICK" name=3D"n= nn2" style=3D"color: #000000 !important; text-decoration: none !important;"= data-cms-ai=3D"0"> <span=20= style=3D"color: #000000; text-decoration: none;"> Hope Around the World </span> </a> </h2> </td> </tr> <tr> <td style=3D"color: #6c6c6c !important;= "> <p style=3D"margin-top: 0; margin-b= ottom: 0 !important; font-size: 0.9em; color: #6c6c6c !important; line-heig= ht: 1.5em;"> <span style=3D"color: #6c6c6c;"= > Aaron Betsky finds optimism,= collective action, and innovation in the conference and community of The= World Around, a New York=E2=80=93based nonprofit. Its… </span> <a href=3D"http://click1.e.hw-commercialdesign.com/qmhjpsydmwfthfvstvqfstyf= fytfwhvjcmgmrcpmwdgwpd_qvvvsnndmftmffwpsdwnn.html" xt=3D"SPCLICK" name=3D"n= nn3" style=3D"display: inline-block !important; color: #00aeed !important;= text-decoration: none !important;" class=3D"moreLink" data-cms-ai=3D"0">= <span class=3D"moreLink" style=3D"display: inl= ine-block; color: #00aeed; text-decoration: none; text-transform: uppercase= ;"> Read More </span> </a> </p> </td> </tr> </tbody> </table> </td> </tr> </tbody> </table> </td> </tr> <tr> <td height=3D"18"> </td> </tr> <tr> <td width=3D"100%" colspan=3D"3" style=3D"border-collapse: collapse; mso-table-lspace: 0pt; mso-tabl= e-rspace: 0pt;"> <table width=3D"100%" cellspacing=3D"0" cellpadding=3D"0"> <tbody> <tr> <td class=3D"mobileColToRow extra-padding" width=3D"300= " valign=3D"top" style=3D"padding-left: 0; width: 300px;"> <div class=3D"mobileThumbnail" style=3D"width: 300p= x; overflow: hidden;"> <a href=3D"http://click1.e.hw-commercialdesign.com/ibgtnvpcyhdwzdbvwbkdvwpd= dpwdhzbtrymyqrnyhcmhzg_qvvvsnndmftmffwpsdwnn.html" xt=3D"SPCLICK" name=3D"n= nn4" style=3D"color:#000 !important; text-decoration: none !important;" dat= a-cms-ai=3D"0"><img src=3D"https://cdnassets.hw.net/dims4/GG/06de258/214748= 3647/thumbnail/300x200%3E/quality/90/?url=3Dhttps%3A%2F%2Fcdnassets.hw.net%= 2Fd2%2Fe4%2F527751454814a84e60fce348205d%2Ftwilight-generator-1200x800.jpg"= width=3D"300" height=3D"200" border=3D"0" alt=3D"The Benefits of Propane= Generators vs. Diesel" data-size=3D"promo_300x200"></a> =20= </div> </td> <td style=3D"border-collapse: collapse; mso-table-lspac= e: 0pt; mso-table-rspace: 0pt;"> <table class=3D"img-spacer" width=3D"12" align=3D"c= enter" style=3D"width: 12px; height: 0;"> <tr> <td> </td> </tr> </table> </td> <td class=3D"mobileColToRow" width=3D"303" colspan=3D"1= " rowspan=3D"1" valign=3D"top" style=3D"clear: both; padding-left: 0; "> <table width=3D"100%"> <tbody> <tr> <td class=3D"eyebrow" style=3D"color:= #ed1f24; padding-bottom: 5px;"> <p style=3D"display: inline-block= !important; color: #ed1f24 !important; margin-top: 0; margin-bottom: 0 !im= portant; font-size: 0.7em; font-weight: bold; text-transform: uppercase;"> <span style=3D"display: inline-= block; color: #ed1f24;"> brought to you by Propane=20= Education & Research Council </span> </p> </td> </tr> <tr> <td style=3D"color: #000000 !important;= "> <h2 style=3D"display: inline-block= !important; color: #000000; margin-top: 0; margin-bottom: 0 !important;=20= font-size: 1.4em; font-weight: bold; line-height: 1.1em;"> <a href=3D"http://click1.e.hw-commercialdesign.com/qvmjpsydmwfthfvstvqfstyf= fytfwhvjcmgmrcpmwdgwhm_qvvvsnndmftmffwpsdwnn.html" xt=3D"SPCLICK" name=3D"n= nn5" style=3D"color: #000000 !important; text-decoration: none !important;"= data-cms-ai=3D"0"> <span=20= style=3D"color: #000000; text-decoration: none;"> The Benefits of Propane= Generators vs. Diesel </span> </a> </h2> </td> </tr> <tr> <td style=3D"color: #6c6c6c !important;= "> <p style=3D"margin-top: 0; margin-b= ottom: 0 !important; font-size: 0.9em; color: #6c6c6c !important; line-heig= ht: 1.5em;"> <span style=3D"color: #6c6c6c;"= > A new report provides archit= ects and engineers with data on the emissions performance of different gene= rators. </span> <a href=3D"http://click1.e.hw-commercialdesign.com/bjlscfvzplqybqjfyjkqfyvq= qvyqlbjsnpgpmncplzglbl_qvvvsnndmftmffwpsdwnn.html" xt=3D"SPCLICK" name=3D"n= nn6" style=3D"display: inline-block !important; color: #00aeed !important;= text-decoration: none !important;" class=3D"moreLink" data-cms-ai=3D"0">= <span class=3D"moreLink" style=3D"display: inl= ine-block; color: #00aeed; text-decoration: none; text-transform: uppercase= ;"> Read More </span> </a> </p> </td> </tr> </tbody> </table> </td> </tr> </tbody> </table> </td> </tr> <tr> <td height=3D"18"> </td> </tr> <tr> <td class=3D"50-50" width=3D"100%" colspan=3D"3" style=3D"border-collapse: collapse; mso-table-lspace: 0pt; mso-tabl= e-rspace: 0pt; padding-bottom: 18px;"> <table width=3D"100%" border=3D"0" cellspacing=3D"0" cellpadding=3D= "0"> <tr> <td class=3D"mobileColToRow" align=3D"left" valign=3D"top" style=3D"border-= collapse: collapse; mso-table-lspace: 0pt; mso-table-rspace: 0pt; margin-to= p: 0; margin-right: 0; margin-bottom: 0; margin-left: 0; padding-top: 0;=20= padding-right: 0; padding-bottom: 0; padding-left: 0;"> <table border=3D"0" cellspacing=3D"0" cellpadding=3D"0" width=3D"300"> <tbody> <tr> <th style=3D"color: #000 !important; float: left; padding-left:= 5px; padding-bottom: 5px; font: 9pt arial;"> =20 </th> </tr> <tr> <td class=3D"mobileColToRow extra-padding" rowspan=3D"1" colspan=3D"1" valign=3D"top" style=3D"width: 300px; padding-left: 0px; "> <div class=3D"mobileThumbnail" style=3D"width: 300px; overflow: hidden;"> <a href=3D"http://click1.e.hw-commercialdesign.com/ntfcrfgkqypnjptfnthpfngp= pgnpyjtcbqdqmbrqykdyjf_qvvvsnndmftmffwpsdwnn.html" xt=3D"SPCLICK" name=3D"n= nn7" style=3D"color:#000 !important; text-decoration: none !important;" dat= a-cms-ai=3D"0"><img src=3D"https://cdnassets.hw.net/dims4/GG/d4559b4/214748= 3647/thumbnail/300x200%3E/quality/90/?url=3Dhttps%3A%2F%2Fcdnassets.hw.net%= 2Fdd%2Fab%2F9fb73f204dfc817f3459c8cc1022%2Ftreetheives-hero.jpg" width=3D"3= 00" height=3D"200" border=3D"0" alt=3D"Tree Thieves: Who Owns the Forest?"= data-size=3D"promo_300x200"></a> </div> </td> </tr> <tr> <td style=3D"font-size: 0"> <table class=3D"img-spacer" height=3D"3" align=3D"center"= style=3D"height: 3px; font-size: 0;"><tr><td> </td></tr></table> </td> </tr> <tr> <td class=3D"eyebrow-padding eyebrow" style=3D"color: #ed1f24;= padding-bottom: 5px;"> <p style=3D"display: inline-block !important; color: #ed1f2= 4 !important; margin-top: 0; margin-bottom: 0 !important; font-size: 0.7em;= font-weight: bold; text-transform: uppercase;"> <span style=3D"display: inline-block; color: #ed1f24;">= Mind & Matter</span> </p> </td> </tr> <tr> <td style=3D"color: #000000 !important;"> <h2 style=3D"display: inline-block !important; color: #0000= 00; margin-top: 0; margin-bottom: 0 !important; font-size: 1.4em; font-weig= ht: bold; line-height: 1.1em;"> <a href=3D"http://click1.e.hw-commercialdesign.com/cggkjpvmtdlfqlgpfgrlpfvl= lvfldqgkstctzsjtdmcdqg_qvvvsnndmftmffwpsdwnn.html" xt=3D"SPCLICK" name=3D"n= nn8" style=3D"color: #000000 !important; text-decoration: none !important;"= data-cms-ai=3D"0"> <span style=3D"color: #000000;= text-decoration: none;">Tree Thieves: Who Owns the Forest?</span> </a> </h2> </td> </tr> <tr> <td style=3D"color: #6c6c6c !important;"> <p style=3D"margin-top: 0; margin-bottom: 0 !important; fon= t-size: 0.9em; color: #6c6c6c !important; line-height: 1.5em;"> <span style=3D"color: #6c6c6c;">Illegal timber harvesti= ng has an annual economic impact of $1 billion nationwide. Blaine Brownell= finds, however, that the causes, effects, and…</span> <a href=3D"http://click1.e.hw-commercialdesign.com/drcldhzjtpmfsmrhfrkmhfzm= mzfmpsrlbtctwbdtpjcpsc_qvvvsnndmftmffwpsdwnn.html" xt=3D"SPCLICK" name=3D"n= nn9" style=3D"display: inline-block !important; color: #00aeed !important;= text-decoration: none !important;" class=3D"moreLink" data-cms-ai=3D"0">= <span class=3D"moreLink" style=3D"display: inline-b= lock; color: #00aeed; text-decoration: none; text-transform: uppercase;">Re= ad More</span> </a> </p> </td> </tr> </tbody> </table> </td> <td> <table class=3D"spacer" width=3D"12" align=3D"c= enter" style=3D"width: 12px; height: 0;"> <tr> <td> </td> </tr> </table> </td> <td class=3D"mobileAdwrapper" align=3D"right" valign=3D"top" style=3D"borde= r-collapse: collapse; mso-table-lspace: 0pt; mso-table-rspace: 0pt; margin-= top: 0; margin-right: 0; margin-bottom: 0; margin-left: 0; padding-top: 0;= padding-right: 0; padding-bottom: 0; padding-left: 0;"> <table align=3D"center" style=3D"font: 7pt arial" bgcolor=3D"#ffffff"= border=3D"0" cellspacing=3D"0" cellpadding=3D"0" width=3D"300"> <tbody> <tr> <th style=3D"color:#000000 !important; float: left; padding-lef= t: 5px; padding-bottom: 5px;"> Advertisement </th> </tr> <tr> <td> <!-- POWERINBOX 300x250 --> <div class=3D"pi_17438 powerinbox"> <!-- domain: rs-stripe.architectmagazine.com --> <table width=3D"300" border=3D"0" cellpadding=3D"0" cellspacing=3D"0"> <tr> <td align=3D"center"> <a href=3D"http://click1.e.hw-commercialdesign.com/ugfzpwvchqfsmfgw= sgbfwsvffvsfqmgzjhnhkjphqcnqmf_qvvvsnndmftmffwpsdwnn.html?a=3Delvis%40ebaar= chitects.org&b=3D53578" style=3D"border-style: none; outline: none; text-de= coration: none;" target=3D"_blank" ref=3D"nofollow"><img alt=3D"" height=3D= "250" src=3D"https://rs-stripe.architectmagazine.com/stripe/image?cs_email= =3Delvis@ebaarchitects.org&cs_sendid=3D53578&cs_esp=3Dpostup&cs_offset=3D0&= cs_stripeid=3D17438&dfp_nl_send_date=3D09/08/2022" style=3D"display: block;= border: 0; height: auto; line-height: 100%; outline: none; text-decoration= : none;" width=3D"300"></a> </td> </tr> </table> </div> <!-- POWERINBOX 300x250 --> </td> </tr> </tbody> </table> </td> </tr> </table> </td> </tr> <tr> <td height=3D"18"> </td> </tr> <tr> <td width=3D"100%" colspan=3D"3" style=3D"border-collapse: collapse; mso-table-lspace: 0pt; mso-tabl= e-rspace: 0pt;"> <table width=3D"100%" cellspacing=3D"0" cellpadding=3D"0"> <tbody> <tr> <td class=3D"mobileColToRow extra-padding" width=3D"300= " valign=3D"top" style=3D"padding-left: 0; width: 300px;"> <div class=3D"mobileThumbnail" style=3D"width: 300p= x; overflow: hidden;"> <a href=3D"http://click1.e.hw-commercialdesign.com/cgjkjpvmtdlfqlgpfgrlpfvl= lvfldqgkstctzsjtdmcdqj_qvvvsnndmftmffwpsdwnn.html" xt=3D"SPCLICK" name=3D"n= nn10" style=3D"color:#000 !important; text-decoration: none !important;"=20= data-cms-ai=3D"0"><img src=3D"https://cdnassets.hw.net/dims4/GG/41d8641/214= 7483647/thumbnail/300x200%3E/quality/90/?url=3Dhttps%3A%2F%2Fcdnassets.hw.n= et%2F6b%2F4a%2Ffd8efdd1470cbcbe4312e081a907%2Fcopyright-barkowphoto-3871.jp= g" width=3D"300" height=3D"200" border=3D"0" alt=3D"Inside Out: Unlocking= a Harmonious Retail Experience through Design" data-size=3D"promo_300x200"= ></a> </div> </td> <td style=3D"border-collapse: collapse; mso-table-lspac= e: 0pt; mso-table-rspace: 0pt;"> <table class=3D"img-spacer" width=3D"12" align=3D"c= enter" style=3D"width: 12px; height: 0;"> <tr> <td> </td> </tr> </table> </td> <td class=3D"mobileColToRow" width=3D"303" colspan=3D"1= " rowspan=3D"1" valign=3D"top" style=3D"clear: both; padding-left: 0; "> <table width=3D"100%"> <tbody> <tr> <td class=3D"eyebrow" style=3D"color:= #ed1f24; padding-bottom: 5px;"> <p style=3D"display: inline-block= !important; color: #ed1f24 !important; margin-top: 0; margin-bottom: 0 !im= portant; font-size: 0.7em; font-weight: bold; text-transform: uppercase;"> <span style=3D"display: inline-= block; color: #ed1f24;"> Inside Out </span> </p> </td> </tr> <tr> <td style=3D"color: #000000 !important;= "> <h2 style=3D"display: inline-block= !important; color: #000000; margin-top: 0; margin-bottom: 0 !important;=20= font-size: 1.4em; font-weight: bold; line-height: 1.1em;"> <a href=3D"http://click1.e.hw-commercialdesign.com/mtszbympcqdlsdtyltgdylmd= dmldqstzjcncvjbcqpnqss_qvvvsnndmftmffwpsdwnn.html" xt=3D"SPCLICK" name=3D"n= nn11" style=3D"color: #000000 !important; text-decoration: none !important;= " data-cms-ai=3D"0"> <span= style=3D"color: #000000; text-decoration: none;"> Inside Out: Unlocking=20= a Harmonious Retail Experience through Design </span> </a> </h2> </td> </tr> <tr> <td style=3D"color: #6c6c6c !important;= "> <p style=3D"margin-top: 0; margin-b= ottom: 0 !important; font-size: 0.9em; color: #6c6c6c !important; line-heig= ht: 1.5em;"> <span style=3D"color: #6c6c6c;"= > In this series on innovative spac= es, Cecilia Quezada, principal and partner at the San Francisco=E2=80=93bas= ed firm Quezada Architecture, and Florencia… </span> <a href=3D"http://click1.e.hw-commercialdesign.com/hsflhbjfvqwzmwsbzsrwbzjw= wjzwqmsldvcvpdhvqfcqmf_qvvvsnndmftmffwpsdwnn.html" xt=3D"SPCLICK" name=3D"n= nn12" style=3D"display: inline-block !important; color: #00aeed !important;= text-decoration: none !important;" class=3D"moreLink" data-cms-ai=3D"0">= <span class=3D"moreLink" style=3D"display: inl= ine-block; color: #00aeed; text-decoration: none; text-transform: uppercase= ;"> Read More </span> </a> </p> </td> </tr> </tbody> </table> </td> </tr> </tbody> </table> </td> </tr> <tr> <td height=3D"18"> </td> </tr> <tr> <td width=3D"100%" colspan=3D"3" style=3D"border-collapse: collapse; mso-table-lspace: 0pt; mso-tabl= e-rspace: 0pt;"> <table width=3D"100%" cellspacing=3D"0" cellpadding=3D"0"> <tbody> <tr> <td class=3D"mobileColToRow extra-padding" width=3D"300= " valign=3D"top" style=3D"padding-left: 0; width: 300px;"> <div class=3D"mobileThumbnail" style=3D"width: 300p= x; overflow: hidden;"> <a href=3D"http://click1.e.hw-commercialdesign.com/qpmjpsydmwfthfvstvqfstyf= fytfwhvjcmgmrcpmwdgwdn_qvvvsnndmftmffwpsdwnn.html" xt=3D"SPCLICK" name=3D"n= nn13" style=3D"color:#000 !important; text-decoration: none !important;"=20= data-cms-ai=3D"0"><img src=3D"https://cdnassets.hw.net/dims4/GG/5358798/214= 7483647/thumbnail/300x200%3E/quality/90/?url=3Dhttps%3A%2F%2Fcdnassets.hw.n= et%2Fed%2F1a%2F31c44b9640c69eed12081eabba50%2Ffiona-cousins-headshot-use.jp= g" width=3D"300" height=3D"200" border=3D"0" alt=3D"Beverly Willis Architec= ture Foundation Honors 2022 Leadership Award Winners" data-size=3D"promo_30= 0x200"></a> </div> </td> <td style=3D"border-collapse: collapse; mso-table-lspac= e: 0pt; mso-table-rspace: 0pt;"> <table class=3D"img-spacer" width=3D"12" align=3D"c= enter" style=3D"width: 12px; height: 0;"> <tr> <td> </td> </tr> </table> </td> <td class=3D"mobileColToRow" width=3D"303" colspan=3D"1= " rowspan=3D"1" valign=3D"top" style=3D"clear: both; padding-left: 0; "> <table width=3D"100%"> <tbody> <tr> <td class=3D"eyebrow" style=3D"color:= #ed1f24; padding-bottom: 5px;"> <p style=3D"display: inline-block= !important; color: #ed1f24 !important; margin-top: 0; margin-bottom: 0 !im= portant; font-size: 0.7em; font-weight: bold; text-transform: uppercase;"> <span style=3D"display: inline-= block; color: #ed1f24;"> Press Release </span> </p> </td> </tr> <tr> <td style=3D"color: #000000 !important;= "> <h2 style=3D"display: inline-block= !important; color: #000000; margin-top: 0; margin-bottom: 0 !important;=20= font-size: 1.4em; font-weight: bold; line-height: 1.1em;"> <a href=3D"http://click1.e.hw-commercialdesign.com/vjvqjpdyfvgnmgkpnkbgpndg= gdngvmkqcfhfzcjfvyhvyf_qvvvsnndmftmffwpsdwnn.html" xt=3D"SPCLICK" name=3D"n= nn14" style=3D"color: #000000 !important; text-decoration: none !important;= " data-cms-ai=3D"0"> <span= style=3D"color: #000000; text-decoration: none;"> Beverly Willis Architect= ure Foundation Honors 2022 Leadership Award Winners </span> </a> </h2> </td> </tr> <tr> <td style=3D"color: #6c6c6c !important;= "> <p style=3D"margin-top: 0; margin-b= ottom: 0 !important; font-size: 0.9em; color: #6c6c6c !important; line-heig= ht: 1.5em;"> <span style=3D"color: #6c6c6c;"= > The New York=E2=80=93based= nonprofit selected six "trailblazing women for their valuable contribution= s to the built environment." </span> <a href=3D"http://click1.e.hw-commercialdesign.com/tmhdmhsplzckjcbhkbfchksc= cskczjbdtlvlrtmlzpvzpz_qvvvsnndmftmffwpsdwnn.html" xt=3D"SPCLICK" name=3D"n= nn15" style=3D"display: inline-block !important; color: #00aeed !important;= text-decoration: none !important;" class=3D"moreLink" data-cms-ai=3D"0">= <span class=3D"moreLink" style=3D"display: inl= ine-block; color: #00aeed; text-decoration: none; text-transform: uppercase= ;"> Read More </span> </a> </p> </td> </tr> </tbody> </table> </td> </tr> </tbody> </table> </td> </tr> <tr> <td height=3D"18"> </td> </tr> <tr> <td class=3D"50-50" width=3D"100%" colspan=3D"3" style=3D"border-collapse: collapse; mso-table-lspace: 0pt; mso-tabl= e-rspace: 0pt; padding-bottom: 18px;"> <table width=3D"100%" border=3D"0" cellspacing=3D"0" cellpadding=3D= "0"> <tr> <td class=3D"mobileColToRow" align=3D"left" valign=3D"top" style=3D"border-= collapse: collapse; mso-table-lspace: 0pt; mso-table-rspace: 0pt; margin-to= p: 0; margin-right: 0; margin-bottom: 0; margin-left: 0; padding-top: 0;=20= padding-right: 0; padding-bottom: 0; padding-left: 0;"> <table border=3D"0" cellspacing=3D"0" cellpadding=3D"0" width=3D"300"> <tbody> <tr> <th style=3D"color: #000 !important; float: left; padding-left:= 5px; padding-bottom: 5px; font: 9pt arial;"> =20 </th> </tr> <tr> <td class=3D"mobileColToRow extra-padding" rowspan=3D"1" colspan=3D"1" valign=3D"top" style=3D"width: 300px; padding-left: 0px; "> <div class=3D"mobileThumbnail" style=3D"width: 300px; overflow: hidden;"> <a href=3D"http://click1.e.hw-commercialdesign.com/vjkqjpdyfvgnmgkpnkbgpndg= gdngvmkqcfhfzcjfvyhvyp_qvvvsnndmftmffwpsdwnn.html" xt=3D"SPCLICK" name=3D"n= nn16" style=3D"color:#000 !important; text-decoration: none !important;"=20= data-cms-ai=3D"0"><img src=3D"https://cdnassets.hw.net/dims4/GG/8430131/214= 7483647/thumbnail/300x200%3E/quality/90/?url=3Dhttps%3A%2F%2Fcdnassets.hw.n= et%2F9f%2Fe7%2Fa6f85def44f48bafb8b985d0d118%2Fadff-general-graphic-resizefo= rnl.jpg" width=3D"300" height=3D"200" border=3D"0" alt=3D"AD:FF Announces= Details of 2022-23 Season" data-size=3D"promo_300x200"></a> =20= </div> </td> </tr> <tr> <td style=3D"font-size: 0"> <table class=3D"img-spacer" height=3D"3" align=3D"center"= style=3D"height: 3px; font-size: 0;"><tr><td> </td></tr></table> </td> </tr> <tr> <td class=3D"eyebrow-padding eyebrow" style=3D"color: #ed1f24;= padding-bottom: 5px;"> <p style=3D"display: inline-block !important; color: #ed1f2= 4 !important; margin-top: 0; margin-bottom: 0 !important; font-size: 0.7em;= font-weight: bold; text-transform: uppercase;"> <span style=3D"display: inline-block; color: #ed1f24;">= Press Release</span> </p> </td> </tr> <tr> <td style=3D"color: #000000 !important;"> <h2 style=3D"display: inline-block !important; color: #0000= 00; margin-top: 0; margin-bottom: 0 !important; font-size: 1.4em; font-weig= ht: bold; line-height: 1.1em;"> <a href=3D"http://click1.e.hw-commercialdesign.com/fgjcghtydsnwrnbhwbznhwtn= ntwnsrbcpdjdlpgdsyjsyb_qvvvsnndmftmffwpsdwnn.html" xt=3D"SPCLICK" name=3D"n= nn17" style=3D"color: #000000 !important; text-decoration: none !important;= " data-cms-ai=3D"0"> <span style=3D"color: #000000;= text-decoration: none;">AD:FF Announces Details of 2022-23 Season</span> </a> </h2> </td> </tr> <tr> <td style=3D"color: #6c6c6c !important;"> <p style=3D"margin-top: 0; margin-bottom: 0 !important; fon= t-size: 0.9em; color: #6c6c6c !important; line-height: 1.5em;"> <span style=3D"color: #6c6c6c;">The Architecture & Desi= gn Film Festival's 14th edition will feature films from countries including= Finland, Denmark, Brazil, Greece, and Italy.</span> <a href=3D"http://click1.e.hw-commercialdesign.com/ddmldhzjtpmfsmrhfrkmhfzm= mzfmpsrlbtctwbdtpjcpjc_qvvvsnndmftmffwpsdwnn.html" xt=3D"SPCLICK" name=3D"n= nn18" style=3D"display: inline-block !important; color: #00aeed !important;= text-decoration: none !important;" class=3D"moreLink" data-cms-ai=3D"0">= <span class=3D"moreLink" style=3D"display: inline-b= lock; color: #00aeed; text-decoration: none; text-transform: uppercase;">Re= ad More</span> </a> </p> </td> </tr> </tbody> </table> </td> <td> <table class=3D"spacer" width=3D"12" align=3D"c= enter" style=3D"width: 12px; height: 0;"> <tr> <td> </td> </tr> </table> </td> <td class=3D"mobileAdwrapper" align=3D"right" valign=3D"top" style=3D"borde= r-collapse: collapse; mso-table-lspace: 0pt; mso-table-rspace: 0pt; margin-= top: 0; margin-right: 0; margin-bottom: 0; margin-left: 0; padding-top: 0;= padding-right: 0; padding-bottom: 0; padding-left: 0;"> <table align=3D"center" style=3D"font: 7pt arial" bgcolor=3D"#ffffff"= border=3D"0" cellspacing=3D"0" cellpadding=3D"0" width=3D"300"> <tbody> <tr> <th style=3D"color:#000000 !important; float: left; padding-lef= t: 5px; padding-bottom: 5px;"> Advertisement </th> </tr> <tr> <td> <!-- POWERINBOX 300x250 --> <div class=3D"pi_17439 powerinbox"> <!-- domain: rs-stripe.architectmagazine.com --> <table width=3D"300" border=3D"0" cellpadding=3D"0" cellspacing=3D"0"> <tr> <td align=3D"center"> <a href=3D"http://click1.e.hw-commercialdesign.com/fggcghtydsnwrnbh= wbznhwtnntwnsrbcpdjdlpgdsyjsyn_qvvvsnndmftmffwpsdwnn.html?a=3Delvis%40ebaar= chitects.org&b=3D53578" style=3D"border-style: none; outline: none; text-de= coration: none;" target=3D"_blank" ref=3D"nofollow"><img alt=3D"" height=3D= "250" src=3D"https://rs-stripe.architectmagazine.com/stripe/image?cs_email= =3Delvis@ebaarchitects.org&cs_sendid=3D53578&cs_esp=3Dpostup&cs_offset=3D0&= cs_stripeid=3D17439&dfp_nl_send_date=3D09/08/2022" style=3D"display: block;= border: 0; height: auto; line-height: 100%; outline: none; text-decoration= : none;" width=3D"300"></a> </td> </tr> </table> </div> <!-- POWERINBOX 300x250 --> </td> </tr> </tbody> </table> </td> </tr> </table> </td> </tr> <tr> <td height=3D"18"> </td> </tr> <tr> <td width=3D"100%" colspan=3D"3" style=3D"border-collapse: collapse; mso-table-lspace: 0pt; mso-tabl= e-rspace: 0pt;"> <table width=3D"100%" cellspacing=3D"0" cellpadding=3D"0"> <tbody> <tr> <td class=3D"mobileColToRow extra-padding" width=3D"300= " valign=3D"top" style=3D"padding-left: 0; width: 300px;"> <div class=3D"mobileThumbnail" style=3D"width: 300p= x; overflow: hidden;"> <a href=3D"http://click1.e.hw-commercialdesign.com/inztnvpcyhdwzdbvwbkdvwpd= dpwdhzbtrymyqrnyhcmhcn_qvvvsnndmftmffwpsdwnn.html" xt=3D"SPCLICK" name=3D"n= nn19" style=3D"color:#000 !important; text-decoration: none !important;"=20= data-cms-ai=3D"0"><img src=3D"https://cdnassets.hw.net/dims4/GG/be0944e/214= 7483647/thumbnail/300x200%3E/quality/90/?url=3Dhttps%3A%2F%2Fcdnassets.hw.n= et%2F7c%2F0c%2F7dfe445b4591ad9c862d311b32ef%2Fhardie-architectural-collecti= on-i-e-boathouse.jpg" width=3D"300" height=3D"200" border=3D"0" alt=3D"Prod= ucts: A=E2=80=9922 Product Highlights" data-size=3D"promo_300x200"></a> =20= </div> </td> <td style=3D"border-collapse: collapse; mso-table-lspac= e: 0pt; mso-table-rspace: 0pt;"> <table class=3D"img-spacer" width=3D"12" align=3D"c= enter" style=3D"width: 12px; height: 0;"> <tr> <td> </td> </tr> </table> </td> <td class=3D"mobileColToRow" width=3D"303" colspan=3D"1= " rowspan=3D"1" valign=3D"top" style=3D"clear: both; padding-left: 0; "> <table width=3D"100%"> <tbody> <tr> <td class=3D"eyebrow" style=3D"color:= #ed1f24; padding-bottom: 5px;"> <p style=3D"display: inline-block= !important; color: #ed1f24 !important; margin-top: 0; margin-bottom: 0 !im= portant; font-size: 0.7em; font-weight: bold; text-transform: uppercase;"> <span style=3D"display: inline-= block; color: #ed1f24;"> Products </span> </p> </td> </tr> <tr> <td style=3D"color: #000000 !important;= "> <h2 style=3D"display: inline-block= !important; color: #000000; margin-top: 0; margin-bottom: 0 !important;=20= font-size: 1.4em; font-weight: bold; line-height: 1.1em;"> <a href=3D"http://click1.e.hw-commercialdesign.com/tmpdmhsplzckjcbhkbfchksc= cskczjbdtlvlrtmlzpvzpj_qvvvsnndmftmffwpsdwnn.html" xt=3D"SPCLICK" name=3D"n= nn20" style=3D"color: #000000 !important; text-decoration: none !important;= " data-cms-ai=3D"0"> <span= style=3D"color: #000000; text-decoration: none;"> Products: A=E2=80=9922= Product Highlights </span> </a> </h2> </td> </tr> <tr> <td style=3D"color: #6c6c6c !important;= "> <p style=3D"margin-top: 0; margin-b= ottom: 0 !important; font-size: 0.9em; color: #6c6c6c !important; line-heig= ht: 1.5em;"> <span style=3D"color: #6c6c6c;"= > From acoustic tiles made from= recycled materials to colorful glass bricks, these 11 products give you=20= a glimpse into the product offerings at the… </span> <a href=3D"http://click1.e.hw-commercialdesign.com/hmnlhbjfvqwzmwsbzsrwbzjw= wjzwqmsldvcvpdhvqfcqff_qvvvsnndmftmffwpsdwnn.html" xt=3D"SPCLICK" name=3D"n= nn21" style=3D"display: inline-block !important; color: #00aeed !important;= text-decoration: none !important;" class=3D"moreLink" data-cms-ai=3D"0">= <span class=3D"moreLink" style=3D"display: inl= ine-block; color: #00aeed; text-decoration: none; text-transform: uppercase= ;"> Read More </span> </a> </p> </td> </tr> </tbody> </table> </td> </tr> </tbody> </table> </td> </tr> <tr> <td height=3D"18"> </td> </tr> <tr> <td width=3D"100%" colspan=3D"3" style=3D"border-collapse: collapse; mso-table-lspace: 0pt; mso-tabl= e-rspace: 0pt;"> <table width=3D"100%" cellspacing=3D"0" cellpadding=3D"0"> <tbody> <tr> <td class=3D"mobileColToRow extra-padding" width=3D"300= " valign=3D"top" style=3D"padding-left: 0; width: 300px;"> <div class=3D"mobileThumbnail" style=3D"width: 300p= x; overflow: hidden;"> <a href=3D"http://click1.e.hw-commercialdesign.com/smvzsvwpbrktlkcvtcfkvtwk= kwtkrlczgbmbhgsbrpmvjj_qvvvsnndmftmffwpsdwnn.html" xt=3D"SPCLICK" name=3D"n= nn22" style=3D"color:#000 !important; text-decoration: none !important;"=20= data-cms-ai=3D"0"><img src=3D"https://cdnassets.hw.net/dims4/GG/561429a/214= 7483647/thumbnail/300x200%3E/quality/90/?url=3Dhttps%3A%2F%2Fcdnassets.hw.n= et%2Fc5%2Fd1%2F151128684b3fb3736bd59562e26c%2Fslc-severna-park-al-courtyard= =2Ejpg" width=3D"300" height=3D"200" border=3D"0" alt=3D"Inside Out: Nurtur= ing Beauty and Community in Assisted Living" data-size=3D"promo_300x200"></= a> </div> </td> <td style=3D"border-collapse: collapse; mso-table-lspac= e: 0pt; mso-table-rspace: 0pt;"> <table class=3D"img-spacer" width=3D"12" align=3D"c= enter" style=3D"width: 12px; height: 0;"> <tr> <td> </td> </tr> </table> </td> <td class=3D"mobileColToRow" width=3D"303" colspan=3D"1= " rowspan=3D"1" valign=3D"top" style=3D"clear: both; padding-left: 0; "> <table width=3D"100%"> <tbody> <tr> <td class=3D"eyebrow" style=3D"color:= #ed1f24; padding-bottom: 5px;"> <p style=3D"display: inline-block= !important; color: #ed1f24 !important; margin-top: 0; margin-bottom: 0 !im= portant; font-size: 0.7em; font-weight: bold; text-transform: uppercase;"> <span style=3D"display: inline-= block; color: #ed1f24;"> Inside Out </span> </p> </td> </tr> <tr> <td style=3D"color: #000000 !important;= "> <h2 style=3D"display: inline-block= !important; color: #000000; margin-top: 0; margin-bottom: 0 !important;=20= font-size: 1.4em; font-weight: bold; line-height: 1.1em;"> <a href=3D"http://click1.e.hw-commercialdesign.com/ungzpwvchqfsmfgwsgbfwsvf= fvsfqmgzjhnhkjphqcnwyh_qvvvsnndmftmffwpsdwnn.html" xt=3D"SPCLICK" name=3D"n= nn23" style=3D"color: #000000 !important; text-decoration: none !important;= " data-cms-ai=3D"0"> <span= style=3D"color: #000000; text-decoration: none;"> Inside Out: Nurturing=20= Beauty and Community in Assisted Living </span> </a> </h2> </td> </tr> <tr> <td style=3D"color: #6c6c6c !important;= "> <p style=3D"margin-top: 0; margin-b= ottom: 0 !important; font-size: 0.9em; color: #6c6c6c !important; line-heig= ht: 1.5em;"> <span style=3D"color: #6c6c6c;"= > In this series on innovative= spaces, the founders of the Chicago-based Harken Interiors tell us how the= y designed an assisted living community that… </span> <a href=3D"http://click1.e.hw-commercialdesign.com/wggtnvkjdlsbzswvbwqsvbks= skbslzwthdgdmhndljgvfl_qvvvsnndmftmffwpsdwnn.html" xt=3D"SPCLICK" name=3D"n= nn24" style=3D"display: inline-block !important; color: #00aeed !important;= text-decoration: none !important;" class=3D"moreLink" data-cms-ai=3D"0">= <span class=3D"moreLink" style=3D"display: inl= ine-block; color: #00aeed; text-decoration: none; text-transform: uppercase= ;"> Read More </span> </a> </p> </td> </tr> </tbody> </table> </td> </tr> </tbody> </table> </td> </tr> <tr> <td height=3D"18"> </td> </tr> <tr> <td width=3D"100%" colspan=3D"3" style=3D"border-collapse: collapse; mso-table-lspace: 0pt; mso-tabl= e-rspace: 0pt;"> <table width=3D"100%" cellspacing=3D"0" cellpadding=3D"0"> <tbody> <tr> <td class=3D"mobileColToRow extra-padding" width=3D"300= " valign=3D"top" style=3D"padding-left: 0; width: 300px;"> <div class=3D"mobileThumbnail" style=3D"width: 300p= x; overflow: hidden;"> <a href=3D"http://click1.e.hw-commercialdesign.com/vhgqjpdyfvgnmgkpnkbgpndg= gdngvmkqcfhfzcjfvyhprp_qvvvsnndmftmffwpsdwnn.html" xt=3D"SPCLICK" name=3D"n= nn25" style=3D"color:#000 !important; text-decoration: none !important;"=20= data-cms-ai=3D"0"><img src=3D"https://cdnassets.hw.net/dims4/GG/7b7948d/214= 7483647/thumbnail/300x200%3E/quality/90/?url=3Dhttps%3A%2F%2Fcdnassets.hw.n= et%2F9c%2Ffc%2F130ca74e44b19ceb3983de136c4b%2Fsummer-reading-hero.jpg" widt= h=3D"300" height=3D"200" border=3D"0" alt=3D"New Design Books to Read Now"= data-size=3D"promo_300x200"></a> </div> </td> <td style=3D"border-collapse: collapse; mso-table-lspac= e: 0pt; mso-table-rspace: 0pt;"> <table class=3D"img-spacer" width=3D"12" align=3D"c= enter" style=3D"width: 12px; height: 0;"> <tr> <td> </td> </tr> </table> </td> <td class=3D"mobileColToRow" width=3D"303" colspan=3D"1= " rowspan=3D"1" valign=3D"top" style=3D"clear: both; padding-left: 0; "> <table width=3D"100%"> <tbody> <tr> <td class=3D"eyebrow" style=3D"color:= #ed1f24; padding-bottom: 5px;"> <p style=3D"display: inline-block= !important; color: #ed1f24 !important; margin-top: 0; margin-bottom: 0 !im= portant; font-size: 0.7em; font-weight: bold; text-transform: uppercase;"> <span style=3D"display: inline-= block; color: #ed1f24;"> Books 2022 </span> </p> </td> </tr> <tr> <td style=3D"color: #000000 !important;= "> <h2 style=3D"display: inline-block= !important; color: #000000; margin-top: 0; margin-bottom: 0 !important;=20= font-size: 1.4em; font-weight: bold; line-height: 1.1em;"> <a href=3D"http://click1.e.hw-commercialdesign.com/imntnvpcyhdwzdbvwbkdvwpd= dpwdhzbtrymyqrnyhcmvgb_qvvvsnndmftmffwpsdwnn.html" xt=3D"SPCLICK" name=3D"n= nn26" style=3D"color: #000000 !important; text-decoration: none !important;= " data-cms-ai=3D"0"> <span= style=3D"color: #000000; text-decoration: none;"> New Design Books to Rea= d Now </span> </a> </h2> </td> </tr> <tr> <td style=3D"color: #6c6c6c !important;= "> <p style=3D"margin-top: 0; margin-b= ottom: 0 !important; font-size: 0.9em; color: #6c6c6c !important; line-heig= ht: 1.5em;"> <span style=3D"color: #6c6c6c;"= > From a global celebration of= queer spaces to an unprecedented tome about women architects and a survey= of the use of color in Japanese design, this… </span> <a href=3D"http://click1.e.hw-commercialdesign.com/ccqkjpvmtdlfqlgpfgrlpfvl= lvfldqgkstctzsjtdmcphc_qvvvsnndmftmffwpsdwnn.html" xt=3D"SPCLICK" name=3D"n= nn27" style=3D"display: inline-block !important; color: #00aeed !important;= text-decoration: none !important;" class=3D"moreLink" data-cms-ai=3D"0">= <span class=3D"moreLink" style=3D"display: inl= ine-block; color: #00aeed; text-decoration: none; text-transform: uppercase= ;"> Read More </span> </a> </p> </td> </tr> </tbody> </table> </td> </tr> </tbody> </table> </td> </tr> <tr> <td height=3D"18"> </td> </tr> <tr> <td width=3D"100%" colspan=3D"3" style=3D"border-collapse: collapse; mso-table-lspace: 0pt; mso-tabl= e-rspace: 0pt;"> <table width=3D"100%" cellspacing=3D"0" cellpadding=3D"0"> <tbody> <tr> <td class=3D"mobileColToRow extra-padding" width=3D"300= " valign=3D"top" style=3D"padding-left: 0; width: 300px;"> <div class=3D"mobileThumbnail" style=3D"width: 300p= x; overflow: hidden;"> <a href=3D"http://click1.e.hw-commercialdesign.com/unczpwvchqfsmfgwsgbfwsvf= fvsfqmgzjhnhkjphqcnwyf_qvvvsnndmftmffwpsdwnn.html" xt=3D"SPCLICK" name=3D"n= nn28" style=3D"color:#000 !important; text-decoration: none !important;"=20= data-cms-ai=3D"0"><img src=3D"https://cdnassets.hw.net/dims4/GG/a31ed91/214= 7483647/thumbnail/300x200%3E/quality/90/?url=3Dhttps%3A%2F%2Fcdnassets.hw.n= et%2F7e%2F0c%2F1eb573a6448b954f2251d7158830%2Flatch-other-option.jpg" width= =3D"300" height=3D"200" border=3D"0" alt=3D"Designers Select: Smart-Home=20= Technology" data-size=3D"promo_300x200"></a> </div> </td> <td style=3D"border-collapse: collapse; mso-table-lspac= e: 0pt; mso-table-rspace: 0pt;"> <table class=3D"img-spacer" width=3D"12" align=3D"c= enter" style=3D"width: 12px; height: 0;"> <tr> <td> </td> </tr> </table> </td> <td class=3D"mobileColToRow" width=3D"303" colspan=3D"1= " rowspan=3D"1" valign=3D"top" style=3D"clear: both; padding-left: 0; "> <table width=3D"100%"> <tbody> <tr> <td class=3D"eyebrow" style=3D"color:= #ed1f24; padding-bottom: 5px;"> <p style=3D"display: inline-block= !important; color: #ed1f24 !important; margin-top: 0; margin-bottom: 0 !im= portant; font-size: 0.7em; font-weight: bold; text-transform: uppercase;"> <span style=3D"display: inline-= block; color: #ed1f24;"> Designers Select </span> </p> </td> </tr> <tr> <td style=3D"color: #000000 !important;= "> <h2 style=3D"display: inline-block= !important; color: #000000; margin-top: 0; margin-bottom: 0 !important;=20= font-size: 1.4em; font-weight: bold; line-height: 1.1em;"> <a href=3D"http://click1.e.hw-commercialdesign.com/jmszqjcnbrmwfmtjwthmjwcm= mcwmrftzpbvbkpqbrnvjsq_qvvvsnndmftmffwpsdwnn.html" xt=3D"SPCLICK" name=3D"n= nn29" style=3D"color: #000000 !important; text-decoration: none !important;= " data-cms-ai=3D"0"> <span= style=3D"color: #000000; text-decoration: none;"> Designers Select: Smart-= Home Technology </span> </a> </h2> </td> </tr> <tr> <td style=3D"color: #6c6c6c !important;= "> <p style=3D"margin-top: 0; margin-b= ottom: 0 !important; font-size: 0.9em; color: #6c6c6c !important; line-heig= ht: 1.5em;"> <span style=3D"color: #6c6c6c;"= > Looking to integrate smart-t= ech into your residential project? Designers from Buro Happold, Body Lawson= Associates Architects & Planners, and Rowland… </span> <a href=3D"http://click1.e.hw-commercialdesign.com/skbzsvwpbrktlkcvtcfkvtwk= kwtkrlczgbmbhgsbrpmvjl_qvvvsnndmftmffwpsdwnn.html" xt=3D"SPCLICK" name=3D"n= nn30" style=3D"display: inline-block !important; color: #00aeed !important;= text-decoration: none !important;" class=3D"moreLink" data-cms-ai=3D"0">= <span class=3D"moreLink" style=3D"display: inl= ine-block; color: #00aeed; text-decoration: none; text-transform: uppercase= ;"> Read More </span> </a> </p> </td> </tr> </tbody> </table> </td> </tr> </tbody> </table> </td> </tr> <tr> <td height=3D"18"> </td> </tr> <tr> <td width=3D"100%" colspan=3D"3" style=3D"border-collapse: collapse; mso-table-lspace: 0pt; mso-tabl= e-rspace: 0pt;"> <table width=3D"100%" cellspacing=3D"0" cellpadding=3D"0"> <tbody> <tr> <td class=3D"mobileColToRow extra-padding" width=3D"300= " valign=3D"top" style=3D"padding-left: 0; width: 300px;"> <div class=3D"mobileThumbnail" style=3D"width: 300p= x; overflow: hidden;"> <a href=3D"http://click1.e.hw-commercialdesign.com/cldkjpvmtdlfqlgpfgrlpfvl= lvfldqgkstctzsjtdmcphm_qvvvsnndmftmffwpsdwnn.html" xt=3D"SPCLICK" name=3D"n= nn31" style=3D"color:#000 !important; text-decoration: none !important;"=20= data-cms-ai=3D"0"><img src=3D"https://cdnassets.hw.net/dims4/GG/d6c5611/214= 7483647/thumbnail/300x200%3E/quality/90/?url=3Dhttps%3A%2F%2Fcdnassets.hw.n= et%2F6b%2Fa5%2F4691e5c54a93b716dcb5257f5a98%2Ffeature.inge_.rocker.jpg" wid= th=3D"300" height=3D"200" border=3D"0" alt=3D"Ingeborg Rocker Named Chair= of Georgia Tech School of Architecture" data-size=3D"promo_300x200"></a>= </div> </td> <td style=3D"border-collapse: collapse; mso-table-lspac= e: 0pt; mso-table-rspace: 0pt;"> <table class=3D"img-spacer" width=3D"12" align=3D"c= enter" style=3D"width: 12px; height: 0;"> <tr> <td> </td> </tr> </table> </td> <td class=3D"mobileColToRow" width=3D"303" colspan=3D"1= " rowspan=3D"1" valign=3D"top" style=3D"clear: both; padding-left: 0; "> <table width=3D"100%"> <tbody> <tr> <td class=3D"eyebrow" style=3D"color:= #ed1f24; padding-bottom: 5px;"> <p style=3D"display: inline-block= !important; color: #ed1f24 !important; margin-top: 0; margin-bottom: 0 !im= portant; font-size: 0.7em; font-weight: bold; text-transform: uppercase;"> <span style=3D"display: inline-= block; color: #ed1f24;"> Press Release </span> </p> </td> </tr> <tr> <td style=3D"color: #000000 !important;= "> <h2 style=3D"display: inline-block= !important; color: #000000; margin-top: 0; margin-bottom: 0 !important;=20= font-size: 1.4em; font-weight: bold; line-height: 1.1em;"> <a href=3D"http://click1.e.hw-commercialdesign.com/ycfpbqyvslgncgfqnfrgqnyg= gynglcfpwskstwbslvkqsm_qvvvsnndmftmffwpsdwnn.html" xt=3D"SPCLICK" name=3D"n= nn32" style=3D"color: #000000 !important; text-decoration: none !important;= " data-cms-ai=3D"0"> <span= style=3D"color: #000000; text-decoration: none;"> Ingeborg Rocker Named= Chair of Georgia Tech School of Architecture </span> </a> </h2> </td> </tr> <tr> <td style=3D"color: #6c6c6c !important;= "> <p style=3D"margin-top: 0; margin-b= ottom: 0 !important; font-size: 0.9em; color: #6c6c6c !important; line-heig= ht: 1.5em;"> <span style=3D"color: #6c6c6c;"= > Rocker, a partner at the Bos= ton=E2=80=93 and Hong Kong=E2=80=93based firm Rocker-Lange Architects, will= join university effective Sept. 1. </span> <a href=3D"http://click1.e.hw-commercialdesign.com/bbgscfvzplqybqjfyjkqfyvq= qvyqlbjsnpgpmncplzgfpp_qvvvsnndmftmffwpsdwnn.html" xt=3D"SPCLICK" name=3D"n= nn33" style=3D"display: inline-block !important; color: #00aeed !important;= text-decoration: none !important;" class=3D"moreLink" data-cms-ai=3D"0">= <span class=3D"moreLink" style=3D"display: inl= ine-block; color: #00aeed; text-decoration: none; text-transform: uppercase= ;"> Read More </span> </a> </p> </td> </tr> </tbody> </table> </td> </tr> </tbody> </table> </td> </tr> <tr> <td height=3D"18"> </td> </tr> <tr> <td width=3D"100%" colspan=3D"3" style=3D"border-collapse: collapse; mso-table-lspace: 0pt; mso-tabl= e-rspace: 0pt;"> <table width=3D"100%" cellspacing=3D"0" cellpadding=3D"0"> <tbody> <tr> <td class=3D"mobileColToRow extra-padding" width=3D"300= " valign=3D"top" style=3D"padding-left: 0; width: 300px;"> <div class=3D"mobileThumbnail" style=3D"width: 300p= x; overflow: hidden;"> <a href=3D"http://click1.e.hw-commercialdesign.com/bbqscfvzplqybqjfyjkqfyvq= qvyqlbjsnpgpmncplzgfpl_qvvvsnndmftmffwpsdwnn.html" xt=3D"SPCLICK" name=3D"n= nn34" style=3D"color:#000 !important; text-decoration: none !important;"=20= data-cms-ai=3D"0"><img src=3D"https://cdnassets.hw.net/dims4/GG/eba1573/214= 7483647/thumbnail/300x200%3E/quality/90/?url=3Dhttps%3A%2F%2Fcdnassets.hw.n= et%2F27%2Fa0%2Ff527faaf408f908cc87f06ff5e1a%2Fellen-lupton2.jpg" width=3D"3= 00" height=3D"200" border=3D"0" alt=3D"Q+A: Ellen Lupton Reflects on Curato= rial Legacy at Cooper Hewitt" data-size=3D"promo_300x200"></a> =20= </div> </td> <td style=3D"border-collapse: collapse; mso-table-lspac= e: 0pt; mso-table-rspace: 0pt;"> <table class=3D"img-spacer" width=3D"12" align=3D"c= enter" style=3D"width: 12px; height: 0;"> <tr> <td> </td> </tr> </table> </td> <td class=3D"mobileColToRow" width=3D"303" colspan=3D"1= " rowspan=3D"1" valign=3D"top" style=3D"clear: both; padding-left: 0; "> <table width=3D"100%"> <tbody> <tr> <td class=3D"eyebrow" style=3D"color:= #ed1f24; padding-bottom: 5px;"> <p style=3D"display: inline-block= !important; color: #ed1f24 !important; margin-top: 0; margin-bottom: 0 !im= portant; font-size: 0.7em; font-weight: bold; text-transform: uppercase;"> <span style=3D"display: inline-= block; color: #ed1f24;"> Curating Design </span> </p> </td> </tr> <tr> <td style=3D"color: #000000 !important;= "> <h2 style=3D"display: inline-block= !important; color: #000000; margin-top: 0; margin-bottom: 0 !important;=20= font-size: 1.4em; font-weight: bold; line-height: 1.1em;"> <a href=3D"http://click1.e.hw-commercialdesign.com/kfdbdmwplhsjfsrmjrksmjws= swjshfrbzlvlqzdlhpvmlm_qvvvsnndmftmffwpsdwnn.html" xt=3D"SPCLICK" name=3D"n= nn35" style=3D"color: #000000 !important; text-decoration: none !important;= " data-cms-ai=3D"0"> <span= style=3D"color: #000000; text-decoration: none;"> Q+A: Ellen Lupton Refle= cts on Curatorial Legacy at Cooper Hewitt </span> </a> </h2> </td> </tr> <tr> <td style=3D"color: #6c6c6c !important;= "> <p style=3D"margin-top: 0; margin-b= ottom: 0 !important; font-size: 0.9em; color: #6c6c6c !important; line-heig= ht: 1.5em;"> <span style=3D"color: #6c6c6c;"= > At the end of her 30-year=20= tenure, the senior curator of contemporary design talks about how design=20= and museums have changed, her favorite… </span> <a href=3D"http://click1.e.hw-commercialdesign.com/wzztnvkjdlsbzswvbwqsvbks= skbslzwthdgdmhndljgvdw_qvvvsnndmftmffwpsdwnn.html" xt=3D"SPCLICK" name=3D"n= nn36" style=3D"display: inline-block !important; color: #00aeed !important;= text-decoration: none !important;" class=3D"moreLink" data-cms-ai=3D"0">= <span class=3D"moreLink" style=3D"display: inl= ine-block; color: #00aeed; text-decoration: none; text-transform: uppercase= ;"> Read More </span> </a> </p> </td> </tr> </tbody> </table> </td> </tr> </tbody> </table> </td> </tr> <tr> <td height=3D"18"> </td> </tr> <tr> <td height=3D"18"> </td> </tr> =09=09=09=09=09=09=09 <tr> <td width=3D"600" valign=3D"top" align=3D"center" style=3D"padding-bottom: 20px; border-bottom: 3px solid #000;"></td= > </tr> <tr> <td height=3D"10"> </td> </tr><tr> <td style=3D"color: #000000 !important;"><h2 style=3D"displ= ay: inline-block !important; color: #000000; margin-top: 0; margin-bottom:= 0 !important; font-size: 1.0em; font-weight: bold; line-height: 1.1em;">= <span style=3D"color: #ed1f24; text-decoration: none;"> Upcoming Events:= </span></h2></td> </tr> <tr> <td height=3D"10"> </td> </tr> <tr> <td style=3D"color: #000000 !important;= "> <h2 style=3D"display: inline-block= !important; color: #000000; margin-top: 0; margin-bottom: 0 !important;=20= font-size: .9em; font-weight: bold; line-height: 1.1em;"> <a href=3D"http://click1.e.hw-commercialdesign.com/rwlhtnylcrvpwvknpkfvnpyv= vypvrwkhscgcbstcrlgncg_qvvvsnndmftmffwpsdwnn.html" name=3D"nnn50" style=3D"= color: #000000 !important; text-decoration: none !important;" data-cms-ai= =3D"0"> <span style=3D"color= : #000000; text-decoration: none;"> Future Place by Builder<= /a> — Oct 3, 2022 - Oct 4, 2022 | Thompson Hotel, Dallas, TX=20 </span> </a> </h2> </td> </tr> <tr> <td style=3D"color: #6c6c6c !important;= "> <p style=3D"margin-top: 0; margin-b= ottom: 0 !important; font-size: 0.8em; color: #6c6c6c !important; line-heig= ht: 1.5em;"> <span style=3D"color: #6c6c6c;"= > Zonda=E2=80=99s Future Place= conference is dedicated to master planned communities and all the elements= =E2=80=93from finance to management, and from design to development=E2=80= =93 that make them successful. </span> <h2 style=3D"display:= inline-block !important; color: #000000; margin-top: 0; margin-bottom: 0= !important; font-size: 0.8em; font-weight: bold; line-height: 1.1em;"><a= href=3D"http://click1.e.hw-commercialdesign.com/zfzgwpvfrmlkdlbpkbjlpkvllv= klmdbgcrsrqcwrmfsprl_qvvvsnndmftmffwpsdwnn.html" name=3D"nnn51" style=3D"co= lor: #000000 !important; text-decoration: none !important;" data-cms-ai=3D"= 0"> <span class=3D"moreLink" style=3D"display: inl= ine-block; color: #00aeed; text-decoration: none; text-transform: uppercase= ;">Register Now</span> </a></h2></td> </tr> =20 =20 =09=09=09=09=09=09 =09=09=09=09=09=09<tr> <td height=3D"18"> </td> </tr> =20 =09=09=09=09=09=09 <tr> <td style=3D"color: #000000 !important;= "> <h2 style=3D"display: inline-block= !important; color: #000000; margin-top: 0; margin-bottom: 0 !important;=20= font-size: .9em; font-weight: bold; line-height: 1.1em;"> <a href=3D"http://click1.e.hw-commercialdesign.com/zfrgwpvfrmlkdlbpkbjlpkvl= lvklmdbgcrsrqcwrmfsprw_qvvvsnndmftmffwpsdwnn.html" name=3D"nnn52" style=3D"= color: #000000 !important; text-decoration: none !important;" data-cms-ai= =3D"0"> <span style=3D"color= : #000000; text-decoration: none;"> Architect Live</a> &mdas= h; Nov 7, 2022 - Nov 9, 2022 | The Watergate Hotel, Washington, DC=20 </span> </a> </h2> </td> </tr> =09=09=09=09 =09=09=09=09 <tr> <td style=3D"color: #6c6c6c !important;= "> <p style=3D"margin-top: 0; margin-b= ottom: 0 !important; font-size: 0.8em; color: #6c6c6c !important; line-heig= ht: 1.5em;"> <span style=3D"color: #6c6c6c;"= > Explore innovative solutions= to some of today's pressing issues, such as the Covid-19 pandemic, glo= bal warming, and other social concerns. Join us November 7-9, 2022 in Washi= ngton, DC, to explore the… </span> <h2 style=3D"display:= inline-block !important; color: #000000; margin-top: 0; margin-bottom: 0= !important; font-size: 0.8em; font-weight: bold; line-height: 1.1em;"><a= href=3D"http://click1.e.hw-commercialdesign.com/yvlpbqyvslgncgfqnfrgqnyggy= nglcfpwskstwbslvkqsc_qvvvsnndmftmffwpsdwnn.html" name=3D"nnn53" style=3D"co= lor: #000000 !important; text-decoration: none !important;" data-cms-ai=3D"= 0"> <span class=3D"moreLink" style=3D"display: inl= ine-block; color: #00aeed; text-decoration: none; text-transform: uppercase= ;">Register Now</span> </a></h2></td> </tr> =20 =09=09=09=09=09=09 =09=09=09=09=09 =20 =09=09=09=09=09=09=09 =09=09=09=09=09=09<tr> <td width=3D"600" valign=3D"top" align=3D"center" style=3D"padding-bottom: 20px; border-bottom: 3px solid #000;"></td= > </tr> </tr> =20 </tr> =20 =20 =09=09=09=09=09=09=09 =09=09=09=09=09 =20 =09=09=09=09=09 =20 =09=09=09=09=09=09=09 =09=09=09=09=09=09=09 </tr> =20 =20 =09=09=09=09=09=09=09 =09=09=09=09=09 =20 =09=09=09=09=09 =20 =09=09=09=09=09=09=09 =09=09=09=09=09=09=09 </tr> =20 <tr> <td class=3D"mobileSpecialLinks" width=3D"600" style=3D"padding-top:=20= 10px; padding-bottom: 20px;" valign=3D"top"> <span style=3D"margin-top: 0; margin-right: 0; margin-bottom: 0;=20= margin-left: 0; padding-top: 0; padding-right: 0; padding-bottom: 0; paddin= g-left: 0; list-style-type: none;"> =20 =20 <span class=3D"" style=3D"margin-left: 0;"> <a href=3D"http://click1.e.hw-commercialdesign.com/ucwzpwvchqfsmfgwsgbfwsvf= fvsfqmgzjhnhkjphqcnwhc_qvvvsnndmftmffwpsdwnn.html" name=3D"nnn56" style=3D"= color: #ed1f24 !important; text-decoration: none !important;" class=3D"spe= cial-link" target=3D"_blank" data-cms-ai=3D"0"> <span=20= class=3D"special-link" style=3D"color: #ed1f24 !important; font-size:= 1.0em !important;"> Advertise </span> </a> <br /> <span class=3D"" style=3D"margin-left: 0;"> <a href=3D"http://click1.e.hw-commercialdesign.com/bpgscfvzplqybqjfyjkqfyvq= qvyqlbjsnpgpmncplzgfld_qvvvsnndmftmffwpsdwnn.html" name=3D"nnn57" style=3D"= color: #ed1f24 !important; text-decoration: none !important;" class=3D"spe= cial-link" target=3D"_blank" data-cms-ai=3D"0"> <span=20= class=3D"special-link" style=3D"color: #ed1f24 !important; font-size:= 1.0em !important;"> Contact Us </span> </a> =20 =20 </td> </tr> <tr> =20 <table align=3D"center" width=3D"100%" border=3D"0" cellspacing=3D"= 0" cellpadding=3D"0"> <tr> <td> <p style=3D"text-align: center; margin-top: 0; margin-b= ottom: 5px !important; font-size: 1.25em; font-weight: bold; font-style:=20= italic;"> Follow Us </p> </td> </tr> <tr> <td style=3D"text-align: center; padding-left: 5px; padding= -right: 5px;"> <span style=3D"display: inline-block;"> <a name=3D"" style=3D"text-decoration: none;"= href=3D"http://click1.e.hw-commercialdesign.com/vfgqjpdyfvgnmgkpnkbgpndggd= ngvmkqcfhfzcjfvyhpvf_qvvvsnndmftmffwpsdwnn.html" data-cms-ai=3D"0"> <img src=3D"https://cdnassets.hw.net/91/86/377e5fc44ee487474f8ce468e54e/twi= tter-social-icon-circle-resize.png" width=3D"35" height=3D"35" border=3D"0"= > </a> </span> <span> </span> <span style=3D"display: inline-block;"> <a name=3D"" style=3D"text-decoration: none;"= href=3D"http://click1.e.hw-commercialdesign.com/jbqzqjcnbrmwfmtjwthmjwcmmc= wmrftzpbvbkpqbrnvjrr_qvvvsnndmftmffwpsdwnn.html" data-cms-ai=3D"0"> <img src=3D"https://cdnassets.hw.net/51/b1/8422958f420fa89dec46e141ef33/fac= ebook-resize.png" width=3D"35" height=3D"35" border=3D"0"> =20= </a> </span> <span> </span> <span style=3D"display: inline-block;"> <a name=3D"" style=3D"text-decoration: none;"= href=3D"http://click1.e.hw-commercialdesign.com/xdsnjhkcdvbtsbphtplbhtkbbk= tbvspnydrdqyjdvcrhvh_qvvvsnndmftmffwpsdwnn.html" data-cms-ai=3D"0"> <img src=3D"https://cdnassets.hw.net/39/2f/1a3453ae432b833ad88dee73260d/lin= kedin-resize.png" width=3D"35" height=3D"35" border=3D"0"> =20= </a> </span> <span> </span> <span style=3D"display: inline-block;"> <a name=3D"" style=3D"text-decoration: none;"= href=3D"http://click1.e.hw-commercialdesign.com/rclhtnylcrvpwvknpkfvnpyvvy= pvrwkhscgcbstcrlgnrk_qvvvsnndmftmffwpsdwnn.html" data-cms-ai=3D"0"> <img src=3D"https://cdnassets.hw.net/dd/11/e9739a9547fca36c636a7fba9279/ins= tagram-resize.png" width=3D"35" height=3D"35" border=3D"0"> =20= </a> </span> <span> </span> <span style=3D"display: inline-block;"> <a name=3D"" style=3D"text-decoration: none;"= href=3D"http://click1.e.hw-commercialdesign.com/fsqcghtydsnwrnbhwbznhwtnnt= wnsrbcpdjdlpgdsyjhsj_qvvvsnndmftmffwpsdwnn.html" data-cms-ai=3D"0"> <img src=3D"https://cdnassets.hw.net/f3/05/5205782847ab99e767d07c999f52/pin= terest-resize.png" width=3D"35" height=3D"35" border=3D"0"> =20= </a> </span> =20 </td> </tr> </table> </td> </tr> <tr> <td width=3D"600" style=3D"padding-top: 15px; text-align: center; clear= : both;"> =20 =20 <span style=3D"padding-bottom: 10px; font-family: Arial, Helvet= ica, sans-serif; font-size: 1.0em;"> <a href=3D"http://click1.e.hw-commercialdesign.com/khlbdmwplhsjfsrmjrksmjws= swjshfrbzlvlqzdlhpvmhs_qvvvsnndmftmffwpsdwnn.html" name=3D"nnn64" style=3D"= text-decoration: underline !important; color: #00aeed !important;" target= =3D"_blank" data-cms-ai=3D"0">AIA</a> =20 </span> </td> </tr> <tr> <td style=3D"height: 5px; line-height: 0; overflow: hidden; clear: both= ;"> =20 </td> </tr> <tr> <td width=3D"615" style=3D"padding-top: 10px; padding-bottom: 10px; tex= t-align: center; clear: both;"> <p style=3D"margin-top: 0; margin-botto= m:10px; font-size: 0.6em; color: #777 !important;">=20 To make sure you continue to receive our e-mails in your inbox (not in your= bulk or junk folders), please add architectnewswire@e.hw-commercialdesign.= com to your address book or safe sender list. </p> =20 =20 <p style=3D"margin-top: 0; margin-bottom:10px;= font-size: 0.6em; color: #777 !important;"> <a href=3D"http://click1.e.hw-commercialdesign.= com/ozzcrjsqtzldmlkjdkgljdsllsdlzmkcptwtnprtzqwjzr_qvvvsnndmftmffwpsdwnn.ht= ml?a=3Delvis%40ebaarchitects.org" style=3D"color:#00aeef !important; text-d= ecoration: none !important;" data-cms-ai=3D"0">Click Here</a> to unsubscrib= e from ARCHITECT Newswire.</p> <p style=3D"margin-top: 0; margin-bottom:10px; font-size: 0.6em; color: #77= 7 !important;"> =20 =20 =09=09 =20 =20 =09=09 <p style=3D"margin-top: 0; margin-bottom:0; font-= size: 0.6em; color: #777 !important;">=C2=A9 Zonda Media, a Delaware corpor= ation. All Rights Reserved. Republication or re-dissemination of this newsl= etter's content is expressly prohibited without the written permission of= <a href=3D"http://click1.e.hw-commercialdesign.com/tzhdmhsplzckjcbhkbfchks= ccskczjbdtlvlrtmlzpvhzj_qvvvsnndmftmffwpsdwnn.html">Zonda Media, a Delaware= corporation.</a> </p><p style=3D"margin-top: 0; margin-bottom:0; font-size= : 0.6em; color: #777 !important;"> Zonda Media, a Delaware corporation | 1152 15th St. NW | Suite 850 | Washin= gton, DC 20005-5811</p> =09=09=09=09=09=09=09 </td> </tr> </table> </td> </tr> </table> <style type=3D"text/css"> /* Forces Outlook.com to display emails at full width */ .ExternalClass, .ExternalClass p, .ExternalClass span, .ExternalClass= font, .ExternalClass td, .ExternalClass div { line-height: 100%; } .ReadMsgBody { width: 100%; } .ExternalClass { width: 100%; line-height: 100%; } .ExternalClass p { margin-bottom: 0 !important; } /* Override AOL defaults */ body {font-family:Helvetica, Arial, sans-serif;font-size:12pt;margin:= 0;} th {font-size:12pt;} td {color: #6c6c6c;} td.eyebrow p a= [href]= { color: #ed1f24 !important; } /*Yahoo adds span.yshortcuts inside all links*/ a:link, span.yshortcuts { color: #000; /* Link color must be set inline for Gmail*/ background-color: none; border: none; text-decoration: none; } /* Overrides Outlook.com Contextual Highlighting */ span { color: #6c6c6c; border-bottom-width: 0; border-bottom-style: none; } p a:link, p span.yshortcuts { text-decoration: underline; } p a:active, p a:visited, p span.yshortcuts:active { text-decoration: underline; } a:active, a:visited, span.yshortcuts:active { color: #000; background-color: none; border: none; text-decoration: none; } a:hover, span.yshortcuts:hover, span.yshortcuts:focus { text-decoration: underline; } a.special-link, span.special-link { color: #f01e27 !important; text-decoration: none !important; } a.moreLink, span.moreLink, p a= [href]= { color: #00aeed !important; text-decoration: none !important; } h1 { color: #00aeed !important; text-decoration: none !important; } h1, h2, h3, h4, h5, h6, p, span { font-family: Arial, Helvetica, sans-serif; } h2, h4, h5 { color: #000 !important; /* Override Hotmail and Yahoo head tag colo= rs - Must also be set inline */ } h3 { color: #fff !important; } h6 { color: #777 !important; } .quote { color: #00adef !important; } p { margin-bottom: 0 !important; } .footertext { color: #777 !important; } table { border-collapse: collapse; } .MsoNormal { padding-bottom: 0 } /* =3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D= =3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D= =3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D= =3D=3D Mobile =3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D= =3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D= =3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D= =3D=3D */ table= [class=3D"mobileWrapper"]= { width: 650px !important; } table= [class=3D"mobileContent"]= { width: 615px !important; background-color: #ffffff !important; } table= [class=3D"mobileContent"]= td= [class=3D"50-50"]= > table { /*width: 300px !important;*/ max-width: 100% !important; } /*table= [class=3D"mobileContent"]= td= [class=3D"50-50"]= table= [align=3D"left"]= td{ padding-right: 12px !important; }*/ table.mobileContent td.mobileLogo { display: block !important; } table.mobileContent tr.mobileMobileLogo { display: none !important; text-align: left; } table.mobileContent td.mobileSocial img { margin: 0 !important; } table.mobileContent td.mobileSocial td { display: inline-block !important; width: auto !important; } table.mobileContent td.mobileAdwrapper img { border-style: none !important; } table.mobileContent td.extra-padding { padding-top: 5px !important; padding-bottom: 5px !important; } table.mobileContent td.extra-padding-bottom{ padding-bottom:18px !important; } @media only screen and (max-width: 614px) { table= [class=3D"mobileWrapper"]= { display: block !important; width: 350px !important; height: auto !important; padding: 0 15px !important } table= [class=3D"mobileContent"]= , table= [class=3D"mobileContent"]= table, table= [class=3D"mobileContent"]= thead, table= [class=3D"mobileContent"]= tbody, table= [class=3D"mobileContent"]= tfoot, table= [class=3D"mobileContent"]= th, table= [class=3D"mobileContent"]= td, table= [class=3D"mobileContent"]= tr, table= [class=3D"mobileContent"]= div.mobileThumbnail { display: block !important; width: 100% !important; height: auto !important; } table= [class=3D"mobileContent"]= td= [class=3D"50-50"]= > table{ width: 100% !important; float: none !important; clear: both !important; margin: 0 auto !important; } table= [class=3D"mobileContent"]= table= [class=3D"img-spacer"]= { display: none !important; } table= [class=3D"mobileContent"]= td= [class=3D"50-50"]= > table= [class=3D"spacer"]= { width: 100% !important; height: 10px !important; } table= [class=3D"mobileContent"]= td= [class=3D"50-50"]= > table td= [class=3D"mobileAdwrapper"]= { text-align: center !important; } table= [class=3D"mobileContent"]= td= [class=3D"50-50"]= table= [align=3D"left"]= td{ padding-right: 0 !important; } table= [class=3D"mobileContent"]= h3 { min-height: 12px !important; height: auto !important; width: 100% !important; } table= [class=3D"mobileContent"]= .mobileLogo { height: auto; } table= [class=3D"mobileContent"]= td.mobileAdwrapper { padding-left: 0 !important; text-align: center !important; } table= [class=3D"mobileContent"]= div.mobileThumbnail { display: block !important; width: 300px !important; max-height: 200px !important; height: auto !important; overflow: hidden !important; margin: 0 auto; } table= [class=3D"mobileContent"]= div.mobileThumbnail img { width: 300px !important; height: auto !important; } table= [class=3D"mobileContent"]= .mobileLogoImg { width: 300px !important; height: auto !important; } table= [class=3D"mobileContent"]= .mobileLeaderboardAd { padding-left: 0 !important; padding-right: 0 !important; } table= [class=3D"mobileContent"]= .mobileLeaderboardAd div { width: 100% !important; } table= [class=3D"mobileContent"]= .mobileLeaderboardAd img { width: 100% !important; height: auto !important; } table= [class=3D"mobileContent"]= .colSeparator { display: none; } table= [class=3D"mobileContent"]= .mobileDate { border-top: none !important; height: 35px; } table= [class=3D"mobileContent"]= .mobileSpecialLinks td { padding-top: 0 !important; padding-bottom: 20px !important; } table= [class=3D"mobileContent"]= .mobileSpecialLinks ul { font-size: 0; text-align: center; } table= [class=3D"mobileContent"]= .mobileSpecialLinks li { /*padding-right: 25px;*/ font-size: 15px; display: inline-block; } table= [class=3D"mobileContent"]= .mobileSpecialLinks li.mobileFirstChild { /*padding-right: 0px;*/ float: left; } table= [class=3D"mobileContent"]= .mobileSpecialLinks li.mobileLastChild { /*padding-right: 0px;*/ float: right; } table= [class=3D"mobileContent"]= .mobileSpecialLinks li.mobileArrow { background-image: url('http://images.hanleywood.com/newsletters= /arrow-right.png'); width: 14px; height: 14px; float: left; margin-right: 2px; } table= [class=3D"mobileContent"]= .mobileSpecialLinks li.mobileArrow img { display: none; } table= [class=3D"mobileContent"]= .mobileMagazine { float: left; width: 145px; padding-right: 10px; border-bottom: none !important; } table= [class=3D"mobileContent"]= .mobileMagazine div { border-bottom: none !important; } table= [class=3D"mobileContent"]= .mobileMagImg, table= [class=3D"mobileContent"]= .mobileMagImg img { width: 145px !important; height: auto !important; } table= [class=3D"mobileContent"]= .mobilePublicationLinks { float: left; width: 145px; } table= [class=3D"mobileContent"]= .mobilePublicationLinks + tr { clear: both; } table= [class=3D"mobileContent"]= .mobileColToRow { margin-bottom: 10px; } table= [class=3D"mobileContent"]= .mobileSocialIcons { width: 100% border-top: 2px solid #000; height: 34px; padding: 2px 0 !important; } table= [class=3D"mobileContent"]= td.mobileSocial { padding-bottom: 5px; } /* mobile hacks for the current issue before footer */ table= [class=3D"mobileContent"]= tr.mobileMobileLogo td > div { width: 100% !important; overflow: auto !important; height: auto !important; line-height: normal !important; } table= [class=3D"mobileContent"]= tr.mobileMobileLogo { display: block !important; } table= [class=3D"mobileContent"]= tr.mobileMobileLogo td > div { display: block !important; height: auto !important; width: auto !important; } table= [class=3D"mobileContent"]= .utilityLinks a.special-link span.special-link { font-size: 0.6em !important; } table= [class=3D"mobileContent"]= td.mobileSocial img { display: inline-block !important; } table= [class=3D"mobileContent"]= td.extra-padding { padding-top: 0px !important; padding-bottom: 0px !important; } table= [class=3D"mobileContent"]= .zero-height { height: 0px !important; } table= [class=3D"mobileContent"]= div.mobileImage { width: 300px !important; overflow: hidden !important; height: 200px !important; } table= [class=3D"mobileContent"]= div.mobileImage img { width: 300px !important; height: auto !important; } table= [class=3D"mobileContent"]= span#mobileChart { display: block; width: 300px !important; height: 200px !important; } table= [class=3D"mobileContent"]= .colSeparator { display: none; } table= [class=3D"mobileContent"]= .mobileLeftCol { display: inline-block; } table= [class=3D"mobileContent"]= .mobileRightCol { width: 80px !important; float: right; } table= [class=3D"mobileContent"]= .mobileLogo td { display: table-cell; } table= [class=3D"mobileContent"]= .mobileHeader img { max-width: 300px; height: auto; } table= [class=3D"mobileContent"]= .mobileHeader, table= [class=3D"mobileContent"]= .mobileHeader table, table= [class=3D"mobileContent"]= .mobileHeader td { height: auto !important; } table= [class=3D"mobileContent"]= .mobileHeader table { margin-top: 5px !important; margin-bottom: 5px !important; } table= [class=3D"mobileContent"]= .mobileHeaderAd, table= [class=3D"mobileContent"]= .mobileHeaderAd table, table= [class=3D"mobileContent"]= .mobileHeaderAd tbody, table= [class=3D"mobileContent"]= .mobileHeaderAd td, table= [class=3D"mobileContent"]= .mobileHeaderAd tr, table= [class=3D"mobileContent"]= .mobileHeaderAd h6 { width: 80px !important; } table= [class=3D"mobileContent"]= .mobileHeaderAd h6 { font-size: .55em !important; -webkit-text-size-adjust: none; -moz-text-size-adjust: none; -ms-text-size-adjust: none; } table= [class=3D"mobileContent"]= .mobileHeaderAd { ] border: none !important; position: absolute; top: -40px; } table= [class=3D"mobileContent"]= .mobileHeaderAd img { max-width: 80px; height: auto; } table= [class=3D"mobileContent"]= .mobileFooterAd img { width: 300px !important; height: auto !important; } td= [id=3D"mobileHideMagazineIssue"]= { display: none !important;=20 } table= [id=3D"mobileRelative"]= { position: relative !important; top: 50px !important; } } </style> <img src=3D"https://83ce69.efeedbacktrk.com/jbjzqjcnbrmwfmtjwthmjwcmmcwmrft= zpbvbkpqbrnvrqt_qvvvsnndmftmffwpsdwnn.gif" width=3D"0" height=3D"0" alt=3D"= "> <span style=3D"display: none;"><a href=3D'http://click1.e.hw-commerciald= esign.com/tzbdmhsplzckjcbhkbfchksccskczjbdtlvlrtmlzpvhzp_qvvvsnndmftmffwpsd= wnn.html?a=3DA73B9126-8643-4D63-B66B-6284AE151CE7&b=3Dhmbsbnnfvw'>Link</a><= /span> </body> </html>