OwlCyberSecurity - MANAGER
Edit File: 1681837554.M875273P928144.server237.web-hosting.com,S=117011,W=120345
Return-Path: <bounce-mdstywwpcdldqcddlcdscsyydwwlzbympcqd@communication.hanleywood.com> Delivered-To: elvis@ebaarchitects.org Received: from server237.web-hosting.com by server237.web-hosting.com with LMTP id kLQjM/LNPmSQKQ4A7Ypugw (envelope-from <bounce-mdstywwpcdldqcddlcdscsyydwwlzbympcqd@communication.hanleywood.com>) for <elvis@ebaarchitects.org>; Tue, 18 Apr 2023 13:05:54 -0400 Return-path: <bounce-mdstywwpcdldqcddlcdscsyydwwlzbympcqd@communication.hanleywood.com> Envelope-to: elvis@ebaarchitects.org Delivery-date: Tue, 18 Apr 2023 13:05:54 -0400 Received: from mail4.communication.hanleywood.com ([96.46.128.145]:44955) by server237.web-hosting.com with esmtps (TLS1.2) tls TLS_ECDHE_RSA_WITH_AES_256_GCM_SHA384 (Exim 4.95) (envelope-from <bounce-mdstywwpcdldqcddlcdscsyydwwlzbympcqd@communication.hanleywood.com>) id 1poom4-004BO5-UJ for elvis@ebaarchitects.org; Tue, 18 Apr 2023 13:05:54 -0400 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; s=class; d=e.hw-commercialdesign.com; h=Date:From:Reply-To:To:Message-ID:Subject:MIME-Version:Content-Type: Content-Transfer-Encoding:List-Unsubscribe; i=architectnewswire@e.hw-commercialdesign.com; bh=dxk7RFHclmKT9gC6kh43aKall9UxJ9qZ1O+cDtaiyz4=; b=HkxgfKPkR3sIBQnBCUxhmXCesXy+mVZp74r+iZGomF2WSBimEaMqxQg0ATcbrG1En/YryNQ2v0+h oDzia/tHeRH+AB0cav19VvAuV33EPacfPKz7JNibEtQIfnXkAxuXdv0YfqQUbIW1APlykEr4LaCj qENCHEE+x9Mkfo9QOFs= DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; s=class; d=communication.hanleywood.com; h=Date:From:Reply-To:To:Message-ID:Subject:MIME-Version:Content-Type: Content-Transfer-Encoding:List-Unsubscribe; bh=dxk7RFHclmKT9gC6kh43aKall9UxJ9qZ1O+cDtaiyz4=; b=ETX2IiWtBHfh+kM++pd7T8svR5Uubtq5zY9CXxiX3JpgPP+2k9/VHKAOUbmAf8uEN61StEYZbinP y+O5QhXAgQbxGBwg74y1GDq3AitYIiKSXzP7h8UBiZl9KdmEtNvoSirVhkkj4sW57Fo2A+qRTCK1 RFFGgXd3aXJR31P5KTo= Received: by mail4.communication.hanleywood.com id h7r6s82uaicn for <elvis@ebaarchitects.org>; Tue, 18 Apr 2023 12:05:08 -0500 (envelope-from <bounce-mdstywwpcdldqcddlcdscsyydwwlzbympcqd@communication.hanleywood.com>) Date: Tue, 18 Apr 2023 12:05:08 -0500 (CDT) From: Architect Newswire <architectnewswire@e.hw-commercialdesign.com> Reply-To: Hanley Wood <updates@communication.hanleywood.com> To: friend <elvis@ebaarchitects.org> Message-ID: <125776287.16516264.1681837508063@communication.hanleywood.com> Subject: First Look: 21 Standout Tiles to Discover at Coverings 2023 MIME-Version: 1.0 Content-Type: text/html; charset=UTF-8 Content-Transfer-Encoding: quoted-printable X-HANW: sblcmlklbpkktbrbtbjccrbmljk zsvwpbrklkcvcfkvwkkwkrlczgbmbhgstcvjjpbktkrbkktbklblvvkjj bmjrlpsssr List-Unsubscribe: <mailto:unsub-4300916-62166-A73B912686434D63B66B6284AE151CE7@communication.hanleywood.com> X-Spam-Status: No, score=0.8 X-Spam-Score: 8 X-Spam-Bar: / X-Ham-Report: Spam detection software, running on the system "server237.web-hosting.com", has NOT identified this incoming email as spam. The original message has been attached to this so you can view it or label similar future email. If you have any questions, see root\@localhost for details. Content preview: Architect Newswire The Transformative Potential of Design Solidarity Editorial Content analysis details: (0.8 points, 5.0 required) pts rule name description ---- ---------------------- -------------------------------------------------- 0.0 URIBL_BLOCKED ADMINISTRATOR NOTICE: The query to URIBL was blocked. See http://wiki.apache.org/spamassassin/DnsBlocklists#dnsbl-block for more information. [URIs: architectmagazine.com] -0.0 SPF_PASS SPF: sender matches SPF record 0.2 HEADER_FROM_DIFFERENT_DOMAINS From and EnvelopeFrom 2nd level mail domains are different 0.0 HTML_IMAGE_RATIO_04 BODY: HTML has a low ratio of text to image area 0.0 HTML_MESSAGE BODY: HTML included in message 0.1 MIME_HTML_ONLY BODY: Message only has text/html MIME parts -0.1 DKIM_VALID_AU Message has a valid DKIM or DK signature from author's domain -0.1 DKIM_VALID Message has at least one valid DKIM or DK signature 0.1 DKIM_SIGNED Message has a DKIM or DK signature, not necessarily valid 0.0 T_KAM_HTML_FONT_INVALID Test for Invalidly Named or Formatted Colors in HTML 0.5 KAM_NUMSUBJECT Subject ends in numbers excluding current years -0.0 T_SCC_BODY_TEXT_LINE No description available. X-Spam-Flag: NO =20 <!DOCTYPE html PUBLIC "-//W3C//DTD XHTML 1.0 Strict//EN" "http://www.w3= =2Eorg/TR/xhtml1/DTD/xhtml1-strict.dtd"> <html xmlns=3D"http://www.w3.org/1999/xhtml" xmlns:v=3D"urn:schemas-microsoft-com:vml" xmlns:o=3D"urn:schemas-microsoft-com:office:office"> <head profile=3D"http://www.w3.org/2005/10/profile"> <title>Architect Newswire</title> <meta http-equiv=3D"content-type" content=3D"charset=3Dutf-8"/> <meta http-equiv=3D"content-language" content=3D"en-us"/> <meta name=3D"viewport" content=3D"width=3Ddevice-width, initial-scale= =3D1.0, maximum-scale=3D2.0, user-scalable=3Dyes"/> <style type=3D"text/css"> /* Forces Outlook.com to display emails at full width */ .ExternalClass, .ExternalClass p, .ExternalClass span, .ExternalClass= font, .ExternalClass td, .ExternalClass div { line-height: 100%; } .ReadMsgBody { width: 100%; } .ExternalClass { width: 100%; line-height: 100%; } .ExternalClass p { margin-bottom: 0 !important; } /* Override AOL defaults */ body {font-family:Helvetica, Arial, sans-serif;font-size:12pt;margin:= 0;} th {font-size:12pt;} td {color: #6c6c6c;} td.eyebrow p a= [href]= { color: #ed1f24 !important; } /*Yahoo adds span.yshortcuts inside all links*/ a:link, span.yshortcuts { color: #000; /* Link color must be set inline for Gmail*/ background-color: none; border: none; text-decoration: none; } /* Overrides Outlook.com Contextual Highlighting */ span { color: #6c6c6c; border-bottom-width: 0; border-bottom-style: none; } p a:link, p span.yshortcuts { text-decoration: underline; } p a:active, p a:visited, p span.yshortcuts:active { text-decoration: underline; } a:active, a:visited, span.yshortcuts:active { color: #000; background-color: none; border: none; text-decoration: none; } a:hover, span.yshortcuts:hover, span.yshortcuts:focus { text-decoration: underline; } a.special-link, span.special-link { color: #f01e27 !important; text-decoration: none !important; } a.moreLink, span.moreLink, p a= [href]= { color: #00aeed !important; text-decoration: none !important; } h1 { color: #00aeed !important; text-decoration: none !important; } h1, h2, h3, h4, h5, h6, p, span { font-family: Arial, Helvetica, sans-serif; } h2, h4, h5 { color: #000 !important; /* Override Hotmail and Yahoo head tag colo= rs - Must also be set inline */ } h3 { color: #fff !important; } h6 { color: #777 !important; } .quote { color: #00adef !important; } p { margin-bottom: 0 !important; } .footertext { color: #777 !important; } table { border-collapse: collapse; } .MsoNormal { padding-bottom: 0 } /* =3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D= =3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D= =3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D= =3D=3D Mobile =3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D= =3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D= =3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D= =3D=3D */ table= [class=3D"mobileWrapper"]= { width: 650px !important; } table= [class=3D"mobileContent"]= { width: 615px !important; background-color: #ffffff !important; } table= [class=3D"mobileContent"]= td= [class=3D"50-50"]= > table { /*width: 300px !important;*/ max-width: 100% !important; } /*table= [class=3D"mobileContent"]= td= [class=3D"50-50"]= table= [align=3D"left"]= td{ padding-right: 12px !important; }*/ table.mobileContent td.mobileLogo { display: block !important; } table.mobileContent tr.mobileMobileLogo { display: none !important; text-align: left; } table.mobileContent td.mobileSocial img { margin: 0 !important; } table.mobileContent td.mobileSocial td { display: inline-block !important; width: auto !important; } table.mobileContent td.mobileAdwrapper img { border-style: none !important; } table.mobileContent td.extra-padding { padding-top: 5px !important; padding-bottom: 5px !important; } table.mobileContent td.extra-padding-bottom{ padding-bottom:18px !important; } @media only screen and (max-width: 614px) { table= [class=3D"mobileWrapper"]= { display: block !important; width: 350px !important; height: auto !important; padding: 0 15px !important } table= [class=3D"mobileContent"]= , table= [class=3D"mobileContent"]= table, table= [class=3D"mobileContent"]= thead, table= [class=3D"mobileContent"]= tbody, table= [class=3D"mobileContent"]= tfoot, table= [class=3D"mobileContent"]= th, table= [class=3D"mobileContent"]= td, table= [class=3D"mobileContent"]= tr, table= [class=3D"mobileContent"]= div.mobileThumbnail { display: block !important; width: 100% !important; height: auto !important; } table= [class=3D"mobileContent"]= td= [class=3D"50-50"]= > table{ width: 100% !important; float: none !important; clear: both !important; margin: 0 auto !important; } table= [class=3D"mobileContent"]= table= [class=3D"img-spacer"]= { display: none !important; } table= [class=3D"mobileContent"]= td= [class=3D"50-50"]= > table= [class=3D"spacer"]= { width: 100% !important; height: 10px !important; } table= [class=3D"mobileContent"]= td= [class=3D"50-50"]= > table td= [class=3D"mobileAdwrapper"]= { text-align: center !important; } table= [class=3D"mobileContent"]= td= [class=3D"50-50"]= table= [align=3D"left"]= td{ padding-right: 0 !important; } table= [class=3D"mobileContent"]= h3 { min-height: 12px !important; height: auto !important; width: 100% !important; } table= [class=3D"mobileContent"]= .mobileLogo { height: auto; } table= [class=3D"mobileContent"]= td.mobileAdwrapper { padding-left: 0 !important; text-align: center !important; } table= [class=3D"mobileContent"]= div.mobileThumbnail { display: block !important; width: 300px !important; max-height: 200px !important; height: auto !important; overflow: hidden !important; margin: 0 auto; } table= [class=3D"mobileContent"]= div.mobileThumbnail img { width: 300px !important; height: auto !important; } table= [class=3D"mobileContent"]= .mobileLogoImg { width: 300px !important; height: auto !important; } table= [class=3D"mobileContent"]= .mobileLeaderboardAd { padding-left: 0 !important; padding-right: 0 !important; } table= [class=3D"mobileContent"]= .mobileLeaderboardAd div { width: 100% !important; } table= [class=3D"mobileContent"]= .mobileLeaderboardAd img { width: 100% !important; height: auto !important; } table= [class=3D"mobileContent"]= .colSeparator { display: none; } table= [class=3D"mobileContent"]= .mobileDate { border-top: none !important; height: 35px; } table= [class=3D"mobileContent"]= .mobileSpecialLinks td { padding-top: 0 !important; padding-bottom: 20px !important; } table= [class=3D"mobileContent"]= .mobileSpecialLinks ul { font-size: 0; text-align: center; } table= [class=3D"mobileContent"]= .mobileSpecialLinks li { /*padding-right: 25px;*/ font-size: 15px; display: inline-block; } table= [class=3D"mobileContent"]= .mobileSpecialLinks li.mobileFirstChild { /*padding-right: 0px;*/ float: left; } table= [class=3D"mobileContent"]= .mobileSpecialLinks li.mobileLastChild { /*padding-right: 0px;*/ float: right; } table= [class=3D"mobileContent"]= .mobileSpecialLinks li.mobileArrow { background-image: url('http://images.hanleywood.com/newsletters= /arrow-right.png'); width: 14px; height: 14px; float: left; margin-right: 2px; } table= [class=3D"mobileContent"]= .mobileSpecialLinks li.mobileArrow img { display: none; } table= [class=3D"mobileContent"]= .mobileMagazine { float: left; width: 145px; padding-right: 10px; border-bottom: none !important; } table= [class=3D"mobileContent"]= .mobileMagazine div { border-bottom: none !important; } table= [class=3D"mobileContent"]= .mobileMagImg, table= [class=3D"mobileContent"]= .mobileMagImg img { width: 145px !important; height: auto !important; } table= [class=3D"mobileContent"]= .mobilePublicationLinks { float: left; width: 145px; } table= [class=3D"mobileContent"]= .mobilePublicationLinks + tr { clear: both; } table= [class=3D"mobileContent"]= .mobileColToRow { margin-bottom: 10px; } table= [class=3D"mobileContent"]= .mobileSocialIcons { width: 100% border-top: 2px solid #000; height: 34px; padding: 2px 0 !important; } table= [class=3D"mobileContent"]= td.mobileSocial { padding-bottom: 5px; } /* mobile hacks for the current issue before footer */ table= [class=3D"mobileContent"]= tr.mobileMobileLogo td > div { width: 100% !important; overflow: auto !important; height: auto !important; line-height: normal !important; } table= [class=3D"mobileContent"]= tr.mobileMobileLogo { display: block !important; } table= [class=3D"mobileContent"]= tr.mobileMobileLogo td > div { display: block !important; height: auto !important; width: auto !important; } table= [class=3D"mobileContent"]= .utilityLinks a.special-link span.special-link { font-size: 0.6em !important; } table= [class=3D"mobileContent"]= td.mobileSocial img { display: inline-block !important; } table= [class=3D"mobileContent"]= td.extra-padding { padding-top: 0px !important; padding-bottom: 0px !important; } table= [class=3D"mobileContent"]= .zero-height { height: 0px !important; } table= [class=3D"mobileContent"]= div.mobileImage { width: 300px !important; overflow: hidden !important; height: 200px !important; } table= [class=3D"mobileContent"]= div.mobileImage img { width: 300px !important; height: auto !important; } table= [class=3D"mobileContent"]= span#mobileChart { display: block; width: 300px !important; height: 200px !important; } table= [class=3D"mobileContent"]= .colSeparator { display: none; } table= [class=3D"mobileContent"]= .mobileLeftCol { display: inline-block; } table= [class=3D"mobileContent"]= .mobileRightCol { width: 80px !important; float: right; } table= [class=3D"mobileContent"]= .mobileLogo td { display: table-cell; } table= [class=3D"mobileContent"]= .mobileHeader img { max-width: 300px; height: auto; } table= [class=3D"mobileContent"]= .mobileHeader, table= [class=3D"mobileContent"]= .mobileHeader table, table= [class=3D"mobileContent"]= .mobileHeader td { height: auto !important; } table= [class=3D"mobileContent"]= .mobileHeader table { margin-top: 5px !important; margin-bottom: 5px !important; } table= [class=3D"mobileContent"]= .mobileHeaderAd, table= [class=3D"mobileContent"]= .mobileHeaderAd table, table= [class=3D"mobileContent"]= .mobileHeaderAd tbody, table= [class=3D"mobileContent"]= .mobileHeaderAd td, table= [class=3D"mobileContent"]= .mobileHeaderAd tr, table= [class=3D"mobileContent"]= .mobileHeaderAd h6 { width: 80px !important; } table= [class=3D"mobileContent"]= .mobileHeaderAd h6 { font-size: .55em !important; -webkit-text-size-adjust: none; -moz-text-size-adjust: none; -ms-text-size-adjust: none; } table= [class=3D"mobileContent"]= .mobileHeaderAd { ] border: none !important; position: absolute; top: -40px; } table= [class=3D"mobileContent"]= .mobileHeaderAd img { max-width: 80px; height: auto; } table= [class=3D"mobileContent"]= .mobileFooterAd img { width: 300px !important; height: auto !important; } td= [id=3D"mobileHideMagazineIssue"]= { display: none !important;=20 } table= [id=3D"mobileRelative"]= { position: relative !important; top: 50px !important; } } </style> </head> <body style=3D"background-color: #f2f3f5; color: #6c6c6c; font-size: 12pt;= margin-top: 0; margin-right: 0; margin-bottom: 0; margin-left: 0; padding-= top: 0; padding-right: 0; padding-bottom: 0; padding-left: 0;"> <table align=3D"center" width=3D"650" border=3D"0" cellspacing=3D"0" cellpa= dding=3D"0" class=3D"mobileWrapper" style=3D"width: 650px; margin-top: 0; margin-right: auto; margin-bot= tom: 0; margin-left: auto; padding: 0; font-family: Arial, Helvetica, sans-= serif; color: #6c6c6c; background-color: #fff;"> <tr> <td width=3D"615" style=3D"padding: 0; margin: 0; width: 615px;"> <table class=3D"mobileContent" id=3D"" width=3D"615" border=3D"= 0" cellspacing=3D"0" cellpadding=3D"0" align=3D"center" style=3D"margin-top: 0; margin-right: auto; margin-botto= m: 0; margin-left: auto; padding-top: 0; padding-bottom: 0;"> =20 <tr> <td style=3D"color: #6c6c6c !important;"> <p style=3D"margin-top: 0; margin-bottom: 20px !imp= ortant; font-size: 0.85em; color: #6c6c6c !important; "> <strong> <span style=3D"color:#6c6c6c !important;"> The Transformative Potential of Design Solid= arity</span> </strong> </p> </td> </tr> <tr> <td align=3D"center" class=3D"mobileLeaderboardAd" width=3D"600" style=3D"padding-right: 6px; padding-top: 17px; padding-bottom: 3px= ; padding-left: 6px; text-align: center;"> <div style=3D"width: 600px; margin-right: auto; margin-left: auto;"= > <!--POWERINBOX 600x90--> <div class=3D"pi_17416 powerinbox"> <!-- domain: rs-stripe.architectmagazine.com --> <!--= [if (gte mso 9)|(IE)]= ><table align=3D"center" cellpadding=3D"0" cellspacing=3D"0" width=3D"600">= <tr><td><!= [endif]= --> <table width=3D"100%" border=3D"0" cellspacing=3D"0" cellpadding=3D"0"=20= style=3D"width: 100%; max-width: 600px;"> <tbody> <tr> <td width=3D"100%"> <a href=3D"https://click1.e.hw-commercialdesign.com/msyzbympcqdls= dtyltgdylmddmldqstzjcncvjbctbdcys_mpttywwpcdlcdscsyydww.html?a=3Delvis%40eb= aarchitects.org&b=3D62166" style=3D"border-style: none; outline: none; text= -decoration: none;" target=3D"_blank" ref=3D"nofollow" data-cms-ai=3D"0"><i= mg alt=3D"" height=3D"auto" src=3D"https://rs-stripe.architectmagazine.com/= stripe/image?cs_email=3Delvis@ebaarchitects.org&cs_sendid=3D62166&cs_esp=3D= postup&cs_offset=3D0&cs_stripeid=3D17416&dfp_nl_send_date=3D04/17/2023" sty= le=3D"width: 100%; max-width: 600px;display: block; border: 0; height: auto= ; line-height: 100%; outline: none; text-decoration: none;" width=3D"600"><= /a> </td> </tr> </tbody> </table> <!--= [if (gte mso 9)|(IE)]= ></td></tr></table><!= [endif]= --> </div> <!--POWERINBOX 600x90--> </div> </td> </tr> <tr> <td width=3D"100%" valign=3D"top" align=3D"center" height=3D"30" style= =3D"height: 30px;"> =20 </td> </tr> <tr> <td width=3D"100%" valign=3D"top" align=3D"center" style=3D"padding-bottom: 20px; border-bottom: 5px solid #000;"> <a href=3D"https://click1.e.hw-commercialdesign.com/kfrbdmwplhsjfsrmjrk= smjwsswjshfrbzlvlqzdlrdslmp_mpttywwpcdlcdscsyydww.html" name=3D"" style=3D"= color: #000; text-decoration: none;" data-cms-ai=3D"0"> <img src=3D"https://cdnassets.hw.net/5b/f2/0fcd74f94927883a36c1c3aa7f4c/arc= hitect-newsletter-config.png" width=3D"341" height=3D"57" border=3D"0" vspa= ce=3D"8" alt=3D"Architect Newswire" style=3D"vertical-align: bottom; max-wi= dth: 456px; height: auto; margin-top: 0px; margin-bottom: 0" class=3D"mobil= eLogoImg"/> </a> </td> </tr> <tr> <td height=3D"18"> </td> </tr> <tr> <td width=3D"100%" valign=3D"top" class=3D"extra-paddin= g"> <table width=3D"100%" border=3D"0" cellspacing=3D"0= " cellpadding=3D"0"> <tr> <td width=3D"100%" colspan=3D"3" style=3D"border-collapse: collapse; mso-table-lspace: 0pt; mso-tabl= e-rspace: 0pt;"> <table width=3D"100%" cellspacing=3D"0" cellpadding=3D"0"> <tbody> <tr> <td class=3D"mobileColToRow extra-padding" width=3D"300= " valign=3D"top" style=3D"padding-left: 0; width: 300px;"> <div class=3D"mobileThumbnail" style=3D"width: 300p= x; overflow: hidden;"> <a href=3D"https://click1.e.hw-commercialdesign.com/zzlgwpvfrmlkdlbpkbjlpkv= llvklmdbgcrsrqcwrbwlrbz_mpttywwpcdlcdscsyydww.html" xt=3D"SPCLICK" name=3D"= nnn1" style=3D"color:#000 !important; text-decoration: none !important;"=20= data-cms-ai=3D"0"><img src=3D"https://cdnassets.hw.net/dims4/GG/957bda2/214= 7483647/thumbnail/300x200%3E/quality/90/?url=3Dhttps%3A%2F%2Fcdnassets.hw.n= et%2Fee%2Feb%2F513da33b490496269f9a66ce1b72%2Fcarehaus.jpg" width=3D"300"= height=3D"200" border=3D"0" alt=3D"The Transformative Potential of Design= Solidarity" data-size=3D"promo_300x200"></a> </div> </td> <td style=3D"border-collapse: collapse; mso-table-lspac= e: 0pt; mso-table-rspace: 0pt;"> <table class=3D"img-spacer" width=3D"12" align=3D"c= enter" style=3D"width: 12px; height: 0;"> <tr> <td> </td> </tr> </table> </td> <td class=3D"mobileColToRow" width=3D"303" colspan=3D"1= " rowspan=3D"1" valign=3D"top" style=3D"clear: both; padding-left: 0; "> <table width=3D"100%"> <tbody> <tr> <td class=3D"eyebrow" style=3D"color:= #ed1f24; padding-bottom: 5px;"> <p style=3D"display: inline-block= !important; color: #ed1f24 !important; margin-top: 0; margin-bottom: 0 !im= portant; font-size: 0.7em; font-weight: bold; text-transform: uppercase;"> <span style=3D"display: inline-= block; color: #ed1f24;"> Editorial </span> </p> </td> </tr> <tr> <td style=3D"color: #000000 !important;= "> <h2 style=3D"display: inline-block= !important; color: #000000; margin-top: 0; margin-bottom: 0 !important;=20= font-size: 1.4em; font-weight: bold; line-height: 1.1em;"> <a href=3D"https://click1.e.hw-commercialdesign.com/gwljlgsmcytdntkgdkqtgds= ttsdtynkjfcrcpflckltckc_mpttywwpcdlcdscsyydww.html" xt=3D"SPCLICK" name=3D"= nnn2" style=3D"color: #000000 !important; text-decoration: none !important;= " data-cms-ai=3D"0"> <span= style=3D"color: #000000; text-decoration: none;"> The Transformative Pote= ntial of Design Solidarity </span> </a> </h2> </td> </tr> <tr> <td style=3D"color: #6c6c6c !important;= "> <p style=3D"margin-top: 0; margin-b= ottom: 0 !important; font-size: 0.9em; color: #6c6c6c !important; line-heig= ht: 1.5em;"> <span style=3D"color: #6c6c6c;"= > ARCHITECT editor-in-chief=20= Paul Makovsky discusses the importance of architects, designers, and commun= ities working together to develop collective… </span> <a href=3D"https://click1.e.hw-commercialdesign.com/igztnvpcyhdwzdbvwbkdvwp= ddpwdhzbtrymyqrnybndybh_mpttywwpcdlcdscsyydww.html" xt=3D"SPCLICK" name=3D"= nnn3" style=3D"display: inline-block !important; color: #00aeed !important;= text-decoration: none !important;" class=3D"moreLink" data-cms-ai=3D"0">= <span class=3D"moreLink" style=3D"display: inl= ine-block; color: #00aeed; text-decoration: none; text-transform: uppercase= ;"> Read More </span> </a> </p> </td> </tr> </tbody> </table> </td> </tr> </tbody> </table> </td> </tr> <tr> <td height=3D"18"> </td> </tr> <tr> <td width=3D"100%" colspan=3D"3" style=3D"border-collapse: collapse; mso-table-lspace: 0pt; mso-tabl= e-rspace: 0pt;"> <table width=3D"100%" cellspacing=3D"0" cellpadding=3D"0"> <tbody> <tr> <td class=3D"mobileColToRow extra-padding" width=3D"300= " valign=3D"top" style=3D"padding-left: 0; width: 300px;"> <div class=3D"mobileThumbnail" style=3D"width: 300p= x; overflow: hidden;"> <a href=3D"https://click1.e.hw-commercialdesign.com/ymvpbqyvslgncgfqnfrgqny= ggynglcfpwskstwbsfbgsfq_mpttywwpcdlcdscsyydww.html" xt=3D"SPCLICK" name=3D"= nnn4" style=3D"color:#000 !important; text-decoration: none !important;"=20= data-cms-ai=3D"0"><img src=3D"https://cdnassets.hw.net/dims4/GG/5efd7b5/214= 7483647/thumbnail/300x200%3E/quality/90/?url=3Dhttps%3A%2F%2Fcdnassets.hw.n= et%2Fe4%2Fa8%2F4df4c22b4257baf65e2a9c5fe922%2Fimg-5443.jpg" width=3D"300"= height=3D"200" border=3D"0" alt=3D"Beach Resort=E2=80=99s CHP System Prove= s Its Worth During Hurricane" data-size=3D"promo_300x200"></a> =20= </div> </td> <td style=3D"border-collapse: collapse; mso-table-lspac= e: 0pt; mso-table-rspace: 0pt;"> <table class=3D"img-spacer" width=3D"12" align=3D"c= enter" style=3D"width: 12px; height: 0;"> <tr> <td> </td> </tr> </table> </td> <td class=3D"mobileColToRow" width=3D"303" colspan=3D"1= " rowspan=3D"1" valign=3D"top" style=3D"clear: both; padding-left: 0; "> <table width=3D"100%"> <tbody> <tr> <td class=3D"eyebrow" style=3D"color:= #ed1f24; padding-bottom: 5px;"> <p style=3D"display: inline-block= !important; color: #ed1f24 !important; margin-top: 0; margin-bottom: 0 !im= portant; font-size: 0.7em; font-weight: bold; text-transform: uppercase;"> <span style=3D"display: inline-= block; color: #ed1f24;"> brought to you by Propane=20= Education & Research Council </span> </p> </td> </tr> <tr> <td style=3D"color: #000000 !important;= "> <h2 style=3D"display: inline-block= !important; color: #000000; margin-top: 0; margin-bottom: 0 !important;=20= font-size: 1.4em; font-weight: bold; line-height: 1.1em;"> <a href=3D"https://click1.e.hw-commercialdesign.com/erdvzyjqrshfphtyftlhyfj= hhjfhsptvcrbrwczrtzhrtt_mpttywwpcdlcdscsyydww.html" xt=3D"SPCLICK" name=3D"= nnn5" style=3D"color: #000000 !important; text-decoration: none !important;= " data-cms-ai=3D"0"> <span= style=3D"color: #000000; text-decoration: none;"> Beach Resort=E2=80=99s= CHP System Proves Its Worth During Hurricane </span> </a> </h2> </td> </tr> <tr> <td style=3D"color: #6c6c6c !important;= "> <p style=3D"margin-top: 0; margin-b= ottom: 0 !important; font-size: 0.9em; color: #6c6c6c !important; line-heig= ht: 1.5em;"> <span style=3D"color: #6c6c6c;"= > This Puerto Rico tourist des= tination kept its lights on during Hurricane Fiona, thanks to a combined=20= heat and power plant. </span> <a href=3D"https://click1.e.hw-commercialdesign.com/phhrcjwvhqlbdlyjbytljbw= llwblqdyrghmhkgchyclhym_mpttywwpcdlcdscsyydww.html" xt=3D"SPCLICK" name=3D"= nnn6" style=3D"display: inline-block !important; color: #00aeed !important;= text-decoration: none !important;" class=3D"moreLink" data-cms-ai=3D"0">= <span class=3D"moreLink" style=3D"display: inl= ine-block; color: #00aeed; text-decoration: none; text-transform: uppercase= ;"> Read More </span> </a> </p> </td> </tr> </tbody> </table> </td> </tr> </tbody> </table> </td> </tr> <tr> <td height=3D"18"> </td> </tr> <tr> <td class=3D"50-50" width=3D"100%" colspan=3D"3" style=3D"border-collapse: collapse; mso-table-lspace: 0pt; mso-tabl= e-rspace: 0pt; padding-bottom: 18px;"> <table width=3D"100%" border=3D"0" cellspacing=3D"0" cellpadding=3D= "0"> <tr> <td class=3D"mobileColToRow" align=3D"left" valign=3D"top" style=3D"border-= collapse: collapse; mso-table-lspace: 0pt; mso-table-rspace: 0pt; margin-to= p: 0; margin-right: 0; margin-bottom: 0; margin-left: 0; padding-top: 0;=20= padding-right: 0; padding-bottom: 0; padding-left: 0;"> <table border=3D"0" cellspacing=3D"0" cellpadding=3D"0" width=3D"300"> <tbody> <tr> <th style=3D"color: #000 !important; float: left; padding-left:= 5px; padding-bottom: 5px; font: 9pt arial;"> =20 </th> </tr> <tr> <td class=3D"mobileColToRow extra-padding" rowspan=3D"1" colspan=3D"1" valign=3D"top" style=3D"width: 300px; padding-left: 0px; "> <div class=3D"mobileThumbnail" style=3D"width: 300px; overflow: hidden;"> <a href=3D"https://click1.e.hw-commercialdesign.com/qmwjpsydmwfthfvstvqfsty= ffytfwhvjcmgmrcpmvpfmvf_mpttywwpcdlcdscsyydww.html" xt=3D"SPCLICK" name=3D"= nnn7" style=3D"color:#000 !important; text-decoration: none !important;"=20= data-cms-ai=3D"0"><img src=3D"https://cdnassets.hw.net/dims4/GG/c8656c1/214= 7483647/thumbnail/300x200%3E/quality/90/?url=3Dhttps%3A%2F%2Fcdnassets.hw.n= et%2F81%2Fd8%2F1673097140f99e8187917efbb997%2F18-vesuvio-seesaw-calabria-lu= nada-bay-tile.jpg" width=3D"300" height=3D"200" border=3D"0" alt=3D"First= Look: 21 Standout Tiles to Discover at Coverings 2023" data-size=3D"promo_= 300x200"></a> </div> </td> </tr> <tr> <td style=3D"font-size: 0"> <table class=3D"img-spacer" height=3D"3" align=3D"center"= style=3D"height: 3px; font-size: 0;"><tr><td> </td></tr></table> </td> </tr> <tr> <td class=3D"eyebrow-padding eyebrow" style=3D"color: #ed1f24;= padding-bottom: 5px;"> <p style=3D"display: inline-block !important; color: #ed1f2= 4 !important; margin-top: 0; margin-bottom: 0 !important; font-size: 0.7em;= font-weight: bold; text-transform: uppercase;"> <span style=3D"display: inline-block; color: #ed1f24;">= Coverings 2023</span> </p> </td> </tr> <tr> <td style=3D"color: #000000 !important;"> <h2 style=3D"display: inline-block !important; color: #0000= 00; margin-top: 0; margin-bottom: 0 !important; font-size: 1.4em; font-weig= ht: bold; line-height: 1.1em;"> <a href=3D"https://click1.e.hw-commercialdesign.com/gcgjlgsmcytdntkgdkqtgds= ttsdtynkjfcrcpflckltckl_mpttywwpcdlcdscsyydww.html" xt=3D"SPCLICK" name=3D"= nnn8" style=3D"color: #000000 !important; text-decoration: none !important;= " data-cms-ai=3D"0"> <span style=3D"color: #000000;= text-decoration: none;">First Look: 21 Standout Tiles to Discover at Cover= ings 2023</span> </a> </h2> </td> </tr> <tr> <td style=3D"color: #6c6c6c !important;"> <p style=3D"margin-top: 0; margin-bottom: 0 !important; fon= t-size: 0.9em; color: #6c6c6c !important; line-height: 1.5em;"> <span style=3D"color: #6c6c6c;">North America=E2=80=99s= largest international tile and stone exhibition and conference will be hel= d in Orlando, Fla., from April 18=E2=80=9321.</span> <a href=3D"https://click1.e.hw-commercialdesign.com/bpjscfvzplqybqjfyjkqfyv= qqvyqlbjsnpgpmncpjcqpjb_mpttywwpcdlcdscsyydww.html" xt=3D"SPCLICK" name=3D"= nnn9" style=3D"display: inline-block !important; color: #00aeed !important;= text-decoration: none !important;" class=3D"moreLink" data-cms-ai=3D"0">= <span class=3D"moreLink" style=3D"display: inline-b= lock; color: #00aeed; text-decoration: none; text-transform: uppercase;">Re= ad More</span> </a> </p> </td> </tr> </tbody> </table> </td> <td> <table class=3D"spacer" width=3D"12" align=3D"c= enter" style=3D"width: 12px; height: 0;"> <tr> <td> </td> </tr> </table> </td> <td class=3D"mobileAdwrapper" align=3D"right" valign=3D"top" style=3D"borde= r-collapse: collapse; mso-table-lspace: 0pt; mso-table-rspace: 0pt; margin-= top: 0; margin-right: 0; margin-bottom: 0; margin-left: 0; padding-top: 0;= padding-right: 0; padding-bottom: 0; padding-left: 0;"> <table align=3D"center" style=3D"font: 7pt arial" bgcolor=3D"#ffffff"= border=3D"0" cellspacing=3D"0" cellpadding=3D"0" width=3D"300"> <tbody> <tr> <th style=3D"color:#000000 !important; float: left; padding-lef= t: 5px; padding-bottom: 5px;"> Advertisement </th> </tr> <tr> <td> <!-- POWERINBOX 300x250 --> <div class=3D"pi_17417 powerinbox"> <!-- domain: rs-stripe.architectmagazine.com --> <table width=3D"300" border=3D"0" cellpadding=3D"0" cellspacing=3D"0"> <tr> <td align=3D"center"> <a href=3D"https://click1.e.hw-commercialdesign.com/amhvtdrlmkpnspy= dnyzpdnrpprnpksyvcmhmgctmytpmyl_mpttywwpcdlcdscsyydww.html?a=3Delvis%40ebaa= rchitects.org&b=3D62166" style=3D"border-style: none; outline: none; text-d= ecoration: none;" target=3D"_blank" ref=3D"nofollow" data-cms-ai=3D"0"><img= alt=3D"" height=3D"250" src=3D"https://rs-stripe.architectmagazine.com/str= ipe/image?cs_email=3Delvis@ebaarchitects.org&cs_sendid=3D62166&cs_esp=3Dpos= tup&cs_offset=3D0&cs_stripeid=3D17417&dfp_nl_send_date=3D04/17/2023" style= =3D"display: block; border: 0; height: auto; line-height: 100%; outline:=20= none; text-decoration: none;" width=3D"300"></a> </td> </tr> </table> </div> <!-- POWERINBOX 300x250 --> </td> </tr> </tbody> </table> </td> </tr> </table> </td> </tr> <tr> <td height=3D"18"> </td> </tr> <tr> <td width=3D"100%" colspan=3D"3" style=3D"border-collapse: collapse; mso-table-lspace: 0pt; mso-tabl= e-rspace: 0pt;"> <table width=3D"100%" cellspacing=3D"0" cellpadding=3D"0"> <tbody> <tr> <td class=3D"mobileColToRow extra-padding" width=3D"300= " valign=3D"top" style=3D"padding-left: 0; width: 300px;"> <div class=3D"mobileThumbnail" style=3D"width: 300p= x; overflow: hidden;"> <a href=3D"https://click1.e.hw-commercialdesign.com/nfrcrfgkqypnjptfnthpfng= ppgnpyjtcbqdqmbrqtrpqdw_mpttywwpcdlcdscsyydww.html" xt=3D"SPCLICK" name=3D"= nnn10" style=3D"color:#000 !important; text-decoration: none !important;"= data-cms-ai=3D"0"><img src=3D"https://cdnassets.hw.net/dims4/GG/9874f9b/21= 47483647/thumbnail/300x200%3E/quality/90/?url=3Dhttps%3A%2F%2Fcdnassets.hw.= net%2Fcc%2F00%2F6fa23b2146c581336eab3f9cbd88%2Fadobestock-536180787-1.jpeg"= width=3D"300" height=3D"200" border=3D"0" alt=3D"Ali Wolf: Where Have the= Workers Gone?" data-size=3D"promo_300x200"></a> </d= iv> </td> <td style=3D"border-collapse: collapse; mso-table-lspac= e: 0pt; mso-table-rspace: 0pt;"> <table class=3D"img-spacer" width=3D"12" align=3D"c= enter" style=3D"width: 12px; height: 0;"> <tr> <td> </td> </tr> </table> </td> <td class=3D"mobileColToRow" width=3D"303" colspan=3D"1= " rowspan=3D"1" valign=3D"top" style=3D"clear: both; padding-left: 0; "> <table width=3D"100%"> <tbody> <tr> <td class=3D"eyebrow" style=3D"color:= #ed1f24; padding-bottom: 5px;"> <p style=3D"display: inline-block= !important; color: #ed1f24 !important; margin-top: 0; margin-bottom: 0 !im= portant; font-size: 0.7em; font-weight: bold; text-transform: uppercase;"> <span style=3D"display: inline-= block; color: #ed1f24;"> BUILDER </span> </p> </td> </tr> <tr> <td style=3D"color: #000000 !important;= "> <h2 style=3D"display: inline-block= !important; color: #000000; margin-top: 0; margin-bottom: 0 !important;=20= font-size: 1.4em; font-weight: bold; line-height: 1.1em;"> <a href=3D"https://click1.e.hw-commercialdesign.com/eypvzyjqrshfphtyftlhyfj= hhjfhsptvcrbrwczrtzhrbr_mpttywwpcdlcdscsyydww.html" xt=3D"SPCLICK" name=3D"= nnn11" style=3D"color: #000000 !important; text-decoration: none !important= ;" data-cms-ai=3D"0"> <span= style=3D"color: #000000; text-decoration: none;"> Ali Wolf: Where Have the= Workers Gone? </span> </a> </h2> </td> </tr> <tr> <td style=3D"color: #6c6c6c !important;= "> <p style=3D"margin-top: 0; margin-b= ottom: 0 !important; font-size: 0.9em; color: #6c6c6c !important; line-heig= ht: 1.5em;"> <span style=3D"color: #6c6c6c;"= > The Zonda chief economist outline= s four factors contributing to the 'fairly significant' labor shortage in= the U.S. </span> <a href=3D"https://click1.e.hw-commercialdesign.com/zpfgwpvfrmlkdlbpkbjlpkv= llvklmdbgcrsrqcwrbwlrsm_mpttywwpcdlcdscsyydww.html" xt=3D"SPCLICK" name=3D"= nnn12" style=3D"display: inline-block !important; color: #00aeed !important= ; text-decoration: none !important;" class=3D"moreLink" data-cms-ai=3D"0">= <span class=3D"moreLink" style=3D"display: inl= ine-block; color: #00aeed; text-decoration: none; text-transform: uppercase= ;"> Read More </span> </a> </p> </td> </tr> </tbody> </table> </td> </tr> </tbody> </table> </td> </tr> <tr> <td height=3D"18"> </td> </tr> <tr> <td width=3D"100%" colspan=3D"3" style=3D"border-collapse: collapse; mso-table-lspace: 0pt; mso-tabl= e-rspace: 0pt;"> <table width=3D"100%" cellspacing=3D"0" cellpadding=3D"0"> <tbody> <tr> <td class=3D"mobileColToRow extra-padding" width=3D"300= " valign=3D"top" style=3D"padding-left: 0; width: 300px;"> <div class=3D"mobileThumbnail" style=3D"width: 300p= x; overflow: hidden;"> <a href=3D"https://click1.e.hw-commercialdesign.com/cghkjpvmtdlfqlgpfgrlpfv= llvfldqgkstctzsjtgjltcp_mpttywwpcdlcdscsyydww.html" xt=3D"SPCLICK" name=3D"= nnn13" style=3D"color:#000 !important; text-decoration: none !important;"= data-cms-ai=3D"0"><img src=3D"https://cdnassets.hw.net/dims4/GG/cd757a5/21= 47483647/thumbnail/300x200%3E/quality/90/?url=3Dhttps%3A%2F%2Fcdnassets.hw.= net%2Fbf%2F6c%2Fb1664253424fa4627dee9c5c6b4a%2Fds-04.2023.jpg" width=3D"300= " height=3D"200" border=3D"0" alt=3D"Designers Select: Hospitality Products= " data-size=3D"promo_300x200"></a> </div> </td> <td style=3D"border-collapse: collapse; mso-table-lspac= e: 0pt; mso-table-rspace: 0pt;"> <table class=3D"img-spacer" width=3D"12" align=3D"c= enter" style=3D"width: 12px; height: 0;"> <tr> <td> </td> </tr> </table> </td> <td class=3D"mobileColToRow" width=3D"303" colspan=3D"1= " rowspan=3D"1" valign=3D"top" style=3D"clear: both; padding-left: 0; "> <table width=3D"100%"> <tbody> <tr> <td class=3D"eyebrow" style=3D"color:= #ed1f24; padding-bottom: 5px;"> <p style=3D"display: inline-block= !important; color: #ed1f24 !important; margin-top: 0; margin-bottom: 0 !im= portant; font-size: 0.7em; font-weight: bold; text-transform: uppercase;"> <span style=3D"display: inline-= block; color: #ed1f24;"> Designers Select </span> </p> </td> </tr> <tr> <td style=3D"color: #000000 !important;= "> <h2 style=3D"display: inline-block= !important; color: #000000; margin-top: 0; margin-bottom: 0 !important;=20= font-size: 1.4em; font-weight: bold; line-height: 1.1em;"> <a href=3D"https://click1.e.hw-commercialdesign.com/scbzsvwpbrktlkcvtcfkvtw= kkwtkrlczgbmbhgsbcskbmc_mpttywwpcdlcdscsyydww.html" xt=3D"SPCLICK" name=3D"= nnn14" style=3D"color: #000000 !important; text-decoration: none !important= ;" data-cms-ai=3D"0"> <span= style=3D"color: #000000; text-decoration: none;"> Designers Select: Hospit= ality Products </span> </a> </h2> </td> </tr> <tr> <td style=3D"color: #6c6c6c !important;= "> <p style=3D"margin-top: 0; margin-b= ottom: 0 !important; font-size: 0.9em; color: #6c6c6c !important; line-heig= ht: 1.5em;"> <span style=3D"color: #6c6c6c;"= > Three designers share their= project must-haves, from Midcentury Modern furniture to eye-catching decor= ative hardware. </span> <a href=3D"https://click1.e.hw-commercialdesign.com/ugqzpwvchqfsmfgwsgbfwsv= ffvsfqmgzjhnhkjphgpfhnn_mpttywwpcdlcdscsyydww.html" xt=3D"SPCLICK" name=3D"= nnn15" style=3D"display: inline-block !important; color: #00aeed !important= ; text-decoration: none !important;" class=3D"moreLink" data-cms-ai=3D"0">= <span class=3D"moreLink" style=3D"display: inl= ine-block; color: #00aeed; text-decoration: none; text-transform: uppercase= ;"> Read More </span> </a> </p> </td> </tr> </tbody> </table> </td> </tr> </tbody> </table> </td> </tr> <tr> <td height=3D"18"> </td> </tr> <tr> <td class=3D"50-50" width=3D"100%" colspan=3D"3" style=3D"border-collapse: collapse; mso-table-lspace: 0pt; mso-tabl= e-rspace: 0pt; padding-bottom: 18px;"> <table width=3D"100%" border=3D"0" cellspacing=3D"0" cellpadding=3D= "0"> <tr> <td class=3D"mobileColToRow" align=3D"left" valign=3D"top" style=3D"border-= collapse: collapse; mso-table-lspace: 0pt; mso-table-rspace: 0pt; margin-to= p: 0; margin-right: 0; margin-bottom: 0; margin-left: 0; padding-top: 0;=20= padding-right: 0; padding-bottom: 0; padding-left: 0;"> <table border=3D"0" cellspacing=3D"0" cellpadding=3D"0" width=3D"300"> <tbody> <tr> <th style=3D"color: #000 !important; float: left; padding-left:= 5px; padding-bottom: 5px; font: 9pt arial;"> =20 </th> </tr> <tr> <td class=3D"mobileColToRow extra-padding" rowspan=3D"1" colspan=3D"1" valign=3D"top" style=3D"width: 300px; padding-left: 0px; "> <div class=3D"mobileThumbnail" style=3D"width: 300px; overflow: hidden;"> <a href=3D"https://click1.e.hw-commercialdesign.com/okjcrjsqtzldmlkjdkgljds= llsdlzmkcptwtnprtkrltwl_mpttywwpcdlcdscsyydww.html" xt=3D"SPCLICK" name=3D"= nnn16" style=3D"color:#000 !important; text-decoration: none !important;"= data-cms-ai=3D"0"><img src=3D"https://cdnassets.hw.net/dims4/GG/6f08592/21= 47483647/thumbnail/300x200%3E/quality/90/?url=3Dhttps%3A%2F%2Fcdnassets.hw.= net%2F07%2Ffc%2F6c7e667d46b2b95cb322489b7948%2Fcarbonpositive-small.jpg"=20= width=3D"300" height=3D"200" border=3D"0" alt=3D"CarbonPositive: Can We Hal= ve Carbon in the Built Environment?" data-size=3D"promo_300x200"></a> =20= </div> </td> </tr> <tr> <td style=3D"font-size: 0"> <table class=3D"img-spacer" height=3D"3" align=3D"center"= style=3D"height: 3px; font-size: 0;"><tr><td> </td></tr></table> </td> </tr> <tr> <td class=3D"eyebrow-padding eyebrow" style=3D"color: #ed1f24;= padding-bottom: 5px;"> <p style=3D"display: inline-block !important; color: #ed1f2= 4 !important; margin-top: 0; margin-bottom: 0 !important; font-size: 0.7em;= font-weight: bold; text-transform: uppercase;"> <span style=3D"display: inline-block; color: #ed1f24;">= Carbon Positive</span> </p> </td> </tr> <tr> <td style=3D"color: #000000 !important;"> <h2 style=3D"display: inline-block !important; color: #0000= 00; margin-top: 0; margin-bottom: 0 !important; font-size: 1.4em; font-weig= ht: bold; line-height: 1.1em;"> <a href=3D"https://click1.e.hw-commercialdesign.com/vkkqjpdyfvgnmgkpnkbgpnd= ggdngvmkqcfhfzcjfkjgfhj_mpttywwpcdlcdscsyydww.html" xt=3D"SPCLICK" name=3D"= nnn17" style=3D"color: #000000 !important; text-decoration: none !important= ;" data-cms-ai=3D"0"> <span style=3D"color: #000000;= text-decoration: none;">CarbonPositive: Can We Halve Carbon in the Built= Environment?</span> </a> </h2> </td> </tr> <tr> <td style=3D"color: #6c6c6c !important;"> <p style=3D"margin-top: 0; margin-bottom: 0 !important; fon= t-size: 0.9em; color: #6c6c6c !important; line-height: 1.5em;"> <span style=3D"color: #6c6c6c;">Kelly Alvarez Doran,=20= senior director of sustainability and regenerative design at MASS Design=20= Group and senior fellow of Architecture 2030, shares…</span> <a href=3D"https://click1.e.hw-commercialdesign.com/krvbdmwplhsjfsrmjrksmjw= sswjshfrbzlvlqzdlrdslvf_mpttywwpcdlcdscsyydww.html" xt=3D"SPCLICK" name=3D"= nnn18" style=3D"display: inline-block !important; color: #00aeed !important= ; text-decoration: none !important;" class=3D"moreLink" data-cms-ai=3D"0">= <span class=3D"moreLink" style=3D"display: inline-b= lock; color: #00aeed; text-decoration: none; text-transform: uppercase;">Re= ad More</span> </a> </p> </td> </tr> </tbody> </table> </td> <td> <table class=3D"spacer" width=3D"12" align=3D"c= enter" style=3D"width: 12px; height: 0;"> <tr> <td> </td> </tr> </table> </td> <td class=3D"mobileAdwrapper" align=3D"right" valign=3D"top" style=3D"borde= r-collapse: collapse; mso-table-lspace: 0pt; mso-table-rspace: 0pt; margin-= top: 0; margin-right: 0; margin-bottom: 0; margin-left: 0; padding-top: 0;= padding-right: 0; padding-bottom: 0; padding-left: 0;"> <table align=3D"center" style=3D"font: 7pt arial" bgcolor=3D"#ffffff"= border=3D"0" cellspacing=3D"0" cellpadding=3D"0" width=3D"300"> <tbody> <tr> <th style=3D"color:#000000 !important; float: left; padding-lef= t: 5px; padding-bottom: 5px;"> Advertisement </th> </tr> <tr> <td> <!-- POWERINBOX 300x250 --> <div class=3D"pi_17418 powerinbox"> <!-- domain: rs-stripe.architectmagazine.com --> <table width=3D"300" border=3D"0" cellpadding=3D"0" cellspacing=3D"0"> <tr> <td align=3D"center"> <a href=3D"https://click1.e.hw-commercialdesign.com/xpbnjhkcdvbtsbp= htplbhtkbbktbvspnydrdqyjdpjbdrc_mpttywwpcdlcdscsyydww.html?a=3Delvis%40ebaa= rchitects.org&b=3D62166" style=3D"border-style: none; outline: none; text-d= ecoration: none;" target=3D"_blank" ref=3D"nofollow" data-cms-ai=3D"0"><img= alt=3D"" height=3D"250" src=3D"https://rs-stripe.architectmagazine.com/str= ipe/image?cs_email=3Delvis@ebaarchitects.org&cs_sendid=3D62166&cs_esp=3Dpos= tup&cs_offset=3D0&cs_stripeid=3D17418&dfp_nl_send_date=3D04/17/2023" style= =3D"display: block; border: 0; height: auto; line-height: 100%; outline:=20= none; text-decoration: none;" width=3D"300"></a> </td> </tr> </table> </div> <!-- POWERINBOX 300x250 --> </td> </tr> </tbody> </table> </td> </tr> </table> </td> </tr> <tr> <td height=3D"18"> </td> </tr> <tr> <td width=3D"100%" colspan=3D"3" style=3D"border-collapse: collapse; mso-table-lspace: 0pt; mso-tabl= e-rspace: 0pt;"> <table width=3D"100%" cellspacing=3D"0" cellpadding=3D"0"> <tbody> <tr> <td class=3D"mobileColToRow extra-padding" width=3D"300= " valign=3D"top" style=3D"padding-left: 0; width: 300px;"> <div class=3D"mobileThumbnail" style=3D"width: 300p= x; overflow: hidden;"> <a href=3D"https://click1.e.hw-commercialdesign.com/ygcpbqyvslgncgfqnfrgqny= ggynglcfpwskstwbsfbgsgm_mpttywwpcdlcdscsyydww.html" xt=3D"SPCLICK" name=3D"= nnn19" style=3D"color:#000 !important; text-decoration: none !important;"= data-cms-ai=3D"0"><img src=3D"https://cdnassets.hw.net/dims4/GG/49909b0/21= 47483647/thumbnail/300x200%3E/quality/90/?url=3Dhttps%3A%2F%2Fcdnassets.hw.= net%2F6f%2Fb6%2Fac77d36b4e2fa80ecc0652a2137e%2Fimg-1836-dxo.jpg" width=3D"3= 00" height=3D"200" border=3D"0" alt=3D"The Cost of Mining Carrara Marble"= data-size=3D"promo_300x200"></a> </div> </td> <td style=3D"border-collapse: collapse; mso-table-lspac= e: 0pt; mso-table-rspace: 0pt;"> <table class=3D"img-spacer" width=3D"12" align=3D"c= enter" style=3D"width: 12px; height: 0;"> <tr> <td> </td> </tr> </table> </td> <td class=3D"mobileColToRow" width=3D"303" colspan=3D"1= " rowspan=3D"1" valign=3D"top" style=3D"clear: both; padding-left: 0; "> <table width=3D"100%"> <tbody> <tr> <td class=3D"eyebrow" style=3D"color:= #ed1f24; padding-bottom: 5px;"> <p style=3D"display: inline-block= !important; color: #ed1f24 !important; margin-top: 0; margin-bottom: 0 !im= portant; font-size: 0.7em; font-weight: bold; text-transform: uppercase;"> <span style=3D"display: inline-= block; color: #ed1f24;"> Mind & Matter </span> </p> </td> </tr> <tr> <td style=3D"color: #000000 !important;= "> <h2 style=3D"display: inline-block= !important; color: #000000; margin-top: 0; margin-bottom: 0 !important;=20= font-size: 1.4em; font-weight: bold; line-height: 1.1em;"> <a href=3D"https://click1.e.hw-commercialdesign.com/lnhfwgshmknrqndgrdpngrs= nnsrnkqdflmjmclwmdwnmnm_mpttywwpcdlcdscsyydww.html" xt=3D"SPCLICK" name=3D"= nnn20" style=3D"color: #000000 !important; text-decoration: none !important= ;" data-cms-ai=3D"0"> <span= style=3D"color: #000000; text-decoration: none;"> The Cost of Mining Carr= ara Marble </span> </a> </h2> </td> </tr> <tr> <td style=3D"color: #6c6c6c !important;= "> <p style=3D"margin-top: 0; margin-b= ottom: 0 !important; font-size: 0.9em; color: #6c6c6c !important; line-heig= ht: 1.5em;"> <span style=3D"color: #6c6c6c;"= > "Centuries of quarrying stone= from more than 650 sites have significantly impacted the environment," Bla= ine Brownell writes. </span> <a href=3D"https://click1.e.hw-commercialdesign.com/glwjlgsmcytdntkgdkqtgds= ttsdtynkjfcrcpflckltcty_mpttywwpcdlcdscsyydww.html" xt=3D"SPCLICK" name=3D"= nnn21" style=3D"display: inline-block !important; color: #00aeed !important= ; text-decoration: none !important;" class=3D"moreLink" data-cms-ai=3D"0">= <span class=3D"moreLink" style=3D"display: inl= ine-block; color: #00aeed; text-decoration: none; text-transform: uppercase= ;"> Read More </span> </a> </p> </td> </tr> </tbody> </table> </td> </tr> </tbody> </table> </td> </tr> <tr> <td height=3D"18"> </td> </tr> <tr> <td width=3D"100%" colspan=3D"3" style=3D"border-collapse: collapse; mso-table-lspace: 0pt; mso-tabl= e-rspace: 0pt;"> <table width=3D"100%" cellspacing=3D"0" cellpadding=3D"0"> <tbody> <tr> <td class=3D"mobileColToRow extra-padding" width=3D"300= " valign=3D"top" style=3D"padding-left: 0; width: 300px;"> <div class=3D"mobileThumbnail" style=3D"width: 300p= x; overflow: hidden;"> <a href=3D"https://click1.e.hw-commercialdesign.com/zwrgwpvfrmlkdlbpkbjlpkv= llvklmdbgcrsrqcwrbwlrlp_mpttywwpcdlcdscsyydww.html" xt=3D"SPCLICK" name=3D"= nnn22" style=3D"color:#000 !important; text-decoration: none !important;"= data-cms-ai=3D"0"><img src=3D"https://cdnassets.hw.net/dims4/GG/e6752ff/21= 47483647/thumbnail/300x200%3E/quality/90/?url=3Dhttps%3A%2F%2Fcdnassets.hw.= net%2F65%2F3d%2Feefb2eb14c2c8afe906985d175db%2Fhu.jpg" width=3D"300" height= =3D"200" border=3D"0" alt=3D"Rossana Hu to Lead Department of Architecture= at Penn" data-size=3D"promo_300x200"></a> </div> </td> <td style=3D"border-collapse: collapse; mso-table-lspac= e: 0pt; mso-table-rspace: 0pt;"> <table class=3D"img-spacer" width=3D"12" align=3D"c= enter" style=3D"width: 12px; height: 0;"> <tr> <td> </td> </tr> </table> </td> <td class=3D"mobileColToRow" width=3D"303" colspan=3D"1= " rowspan=3D"1" valign=3D"top" style=3D"clear: both; padding-left: 0; "> <table width=3D"100%"> <tbody> <tr> <td class=3D"eyebrow" style=3D"color:= #ed1f24; padding-bottom: 5px;"> <p style=3D"display: inline-block= !important; color: #ed1f24 !important; margin-top: 0; margin-bottom: 0 !im= portant; font-size: 0.7em; font-weight: bold; text-transform: uppercase;"> <span style=3D"display: inline-= block; color: #ed1f24;"> Press Release </span> </p> </td> </tr> <tr> <td style=3D"color: #000000 !important;= "> <h2 style=3D"display: inline-block= !important; color: #000000; margin-top: 0; margin-bottom: 0 !important;=20= font-size: 1.4em; font-weight: bold; line-height: 1.1em;"> <a href=3D"https://click1.e.hw-commercialdesign.com/hhqlhbjfvqwzmwsbzsrwbzj= wwjzwqmsldvcvpdhvshwvws_mpttywwpcdlcdscsyydww.html" xt=3D"SPCLICK" name=3D"= nnn23" style=3D"color: #000000 !important; text-decoration: none !important= ;" data-cms-ai=3D"0"> <span= style=3D"color: #000000; text-decoration: none;"> Rossana Hu to Lead Depar= tment of Architecture at Penn </span> </a> </h2> </td> </tr> <tr> <td style=3D"color: #6c6c6c !important;= "> <p style=3D"margin-top: 0; margin-b= ottom: 0 !important; font-size: 0.9em; color: #6c6c6c !important; line-heig= ht: 1.5em;"> <span style=3D"color: #6c6c6c;"= > She joins the Stuart Weitzman= School of Design as a tenured professor and chair of the department, effec= tive Jan. 1, 2024. </span> <a href=3D"https://click1.e.hw-commercialdesign.com/pcjrcjwvhqlbdlyjbytljbw= llwblqdyrghmhkgchyclhlm_mpttywwpcdlcdscsyydww.html" xt=3D"SPCLICK" name=3D"= nnn24" style=3D"display: inline-block !important; color: #00aeed !important= ; text-decoration: none !important;" class=3D"moreLink" data-cms-ai=3D"0">= <span class=3D"moreLink" style=3D"display: inl= ine-block; color: #00aeed; text-decoration: none; text-transform: uppercase= ;"> Read More </span> </a> </p> </td> </tr> </tbody> </table> </td> </tr> </tbody> </table> </td> </tr> <tr> <td height=3D"18"> </td> </tr> <tr> <td width=3D"100%" colspan=3D"3" style=3D"border-collapse: collapse; mso-table-lspace: 0pt; mso-tabl= e-rspace: 0pt;"> <table width=3D"100%" cellspacing=3D"0" cellpadding=3D"0"> <tbody> <tr> <td class=3D"mobileColToRow extra-padding" width=3D"300= " valign=3D"top" style=3D"padding-left: 0; width: 300px;"> <div class=3D"mobileThumbnail" style=3D"width: 300p= x; overflow: hidden;"> <a href=3D"https://click1.e.hw-commercialdesign.com/zwbgwpvfrmlkdlbpkbjlpkv= llvklmdbgcrsrqcwrbwlrll_mpttywwpcdlcdscsyydww.html" xt=3D"SPCLICK" name=3D"= nnn25" style=3D"color:#000 !important; text-decoration: none !important;"= data-cms-ai=3D"0"><img src=3D"https://cdnassets.hw.net/dims4/GG/587f5ce/21= 47483647/thumbnail/300x200%3E/quality/90/?url=3Dhttps%3A%2F%2Fcdnassets.hw.= net%2Fac%2F43%2Fe09b14994816b4d434284546ea29%2Far-opinion-jeffreyyasuomansf= ield.jpg" width=3D"300" height=3D"200" border=3D"0" alt=3D"Jeffrey Yasuo=20= Mansfield: Advocating for Disability Justice in Design" data-size=3D"promo_= 300x200"></a> </div> </td> <td style=3D"border-collapse: collapse; mso-table-lspac= e: 0pt; mso-table-rspace: 0pt;"> <table class=3D"img-spacer" width=3D"12" align=3D"c= enter" style=3D"width: 12px; height: 0;"> <tr> <td> </td> </tr> </table> </td> <td class=3D"mobileColToRow" width=3D"303" colspan=3D"1= " rowspan=3D"1" valign=3D"top" style=3D"clear: both; padding-left: 0; "> <table width=3D"100%"> <tbody> <tr> <td class=3D"eyebrow" style=3D"color:= #ed1f24; padding-bottom: 5px;"> <p style=3D"display: inline-block= !important; color: #ed1f24 !important; margin-top: 0; margin-bottom: 0 !im= portant; font-size: 0.7em; font-weight: bold; text-transform: uppercase;"> <span style=3D"display: inline-= block; color: #ed1f24;"> Opinion </span> </p> </td> </tr> <tr> <td style=3D"color: #000000 !important;= "> <h2 style=3D"display: inline-block= !important; color: #000000; margin-top: 0; margin-bottom: 0 !important;=20= font-size: 1.4em; font-weight: bold; line-height: 1.1em;"> <a href=3D"https://click1.e.hw-commercialdesign.com/bcgscfvzplqybqjfyjkqfyv= qqvyqlbjsnpgpmncpjcqpqc_mpttywwpcdlcdscsyydww.html" xt=3D"SPCLICK" name=3D"= nnn26" style=3D"color: #000000 !important; text-decoration: none !important= ;" data-cms-ai=3D"0"> <span= style=3D"color: #000000; text-decoration: none;"> Jeffrey Yasuo Mansfield= : Advocating for Disability Justice in Design </span> </a> </h2> </td> </tr> <tr> <td style=3D"color: #6c6c6c !important;= "> <p style=3D"margin-top: 0; margin-b= ottom: 0 !important; font-size: 0.9em; color: #6c6c6c !important; line-heig= ht: 1.5em;"> <span style=3D"color: #6c6c6c;"= > "True justice requires us to= go beyond the legal definition of access," the MASS Design Group principal= writes. "Focusing on codes, rights, and law… </span> <a href=3D"https://click1.e.hw-commercialdesign.com/nrpcrfgkqypnjptfnthpfng= ppgnpyjtcbqdqmbrqtrpqpj_mpttywwpcdlcdscsyydww.html" xt=3D"SPCLICK" name=3D"= nnn27" style=3D"display: inline-block !important; color: #00aeed !important= ; text-decoration: none !important;" class=3D"moreLink" data-cms-ai=3D"0">= <span class=3D"moreLink" style=3D"display: inl= ine-block; color: #00aeed; text-decoration: none; text-transform: uppercase= ;"> Read More </span> </a> </p> </td> </tr> </tbody> </table> </td> </tr> </tbody> </table> </td> </tr> <tr> <td height=3D"18"> </td> </tr> <tr> <td width=3D"100%" colspan=3D"3" style=3D"border-collapse: collapse; mso-table-lspace: 0pt; mso-tabl= e-rspace: 0pt;"> <table width=3D"100%" cellspacing=3D"0" cellpadding=3D"0"> <tbody> <tr> <td class=3D"mobileColToRow extra-padding" width=3D"300= " valign=3D"top" style=3D"padding-left: 0; width: 300px;"> <div class=3D"mobileThumbnail" style=3D"width: 300p= x; overflow: hidden;"> <a href=3D"https://click1.e.hw-commercialdesign.com/fggcghtydsnwrnbhwbznhwt= nntwnsrbcpdjdlpgdbgndny_mpttywwpcdlcdscsyydww.html" xt=3D"SPCLICK" name=3D"= nnn28" style=3D"color:#000 !important; text-decoration: none !important;"= data-cms-ai=3D"0"><img src=3D"https://cdnassets.hw.net/dims4/GG/b65ffa5/21= 47483647/thumbnail/300x200%3E/quality/90/?url=3Dhttps%3A%2F%2Fcdnassets.hw.= net%2Fe4%2Fd3%2F0c5675fc444eaa7b5f4cc4ac92a8%2Fnew-penn-station-image-01.jp= g" width=3D"300" height=3D"200" border=3D"0" alt=3D"In New Public Spaces,= Functionality Trumps Grandeur" data-size=3D"promo_300x200"></a> =20= </div> </td> <td style=3D"border-collapse: collapse; mso-table-lspac= e: 0pt; mso-table-rspace: 0pt;"> <table class=3D"img-spacer" width=3D"12" align=3D"c= enter" style=3D"width: 12px; height: 0;"> <tr> <td> </td> </tr> </table> </td> <td class=3D"mobileColToRow" width=3D"303" colspan=3D"1= " rowspan=3D"1" valign=3D"top" style=3D"clear: both; padding-left: 0; "> <table width=3D"100%"> <tbody> <tr> <td class=3D"eyebrow" style=3D"color:= #ed1f24; padding-bottom: 5px;"> <p style=3D"display: inline-block= !important; color: #ed1f24 !important; margin-top: 0; margin-bottom: 0 !im= portant; font-size: 0.7em; font-weight: bold; text-transform: uppercase;"> <span style=3D"display: inline-= block; color: #ed1f24;"> A Critic's Notebook </span> </p> </td> </tr> <tr> <td style=3D"color: #000000 !important;= "> <h2 style=3D"display: inline-block= !important; color: #000000; margin-top: 0; margin-bottom: 0 !important;=20= font-size: 1.4em; font-weight: bold; line-height: 1.1em;"> <a href=3D"https://click1.e.hw-commercialdesign.com/tppdmhsplzckjcbhkbfchks= ccskczjbdtlvlrtmlbmclmw_mpttywwpcdlcdscsyydww.html" xt=3D"SPCLICK" name=3D"= nnn29" style=3D"color: #000000 !important; text-decoration: none !important= ;" data-cms-ai=3D"0"> <span= style=3D"color: #000000; text-decoration: none;"> In New Public Spaces,=20= Functionality Trumps Grandeur </span> </a> </h2> </td> </tr> <tr> <td style=3D"color: #6c6c6c !important;= "> <p style=3D"margin-top: 0; margin-b= ottom: 0 !important; font-size: 0.9em; color: #6c6c6c !important; line-heig= ht: 1.5em;"> <span style=3D"color: #6c6c6c;"= > Aaron Betsky weighs in on=20= a new proposal for Penn Station in New York. </span> <a href=3D"https://click1.e.hw-commercialdesign.com/rjjhtnylcrvpwvknpkfvnpy= vvypvrwkhscgcbstcktvctc_mpttywwpcdlcdscsyydww.html" xt=3D"SPCLICK" name=3D"= nnn30" style=3D"display: inline-block !important; color: #00aeed !important= ; text-decoration: none !important;" class=3D"moreLink" data-cms-ai=3D"0">= <span class=3D"moreLink" style=3D"display: inl= ine-block; color: #00aeed; text-decoration: none; text-transform: uppercase= ;"> Read More </span> </a> </p> </td> </tr> </tbody> </table> </td> </tr> </tbody> </table> </td> </tr> <tr> <td height=3D"18"> </td> </tr> <tr> <td width=3D"100%" colspan=3D"3" style=3D"border-collapse: collapse; mso-table-lspace: 0pt; mso-tabl= e-rspace: 0pt;"> <table width=3D"100%" cellspacing=3D"0" cellpadding=3D"0"> <tbody> <tr> <td class=3D"mobileColToRow extra-padding" width=3D"300= " valign=3D"top" style=3D"padding-left: 0; width: 300px;"> <div class=3D"mobileThumbnail" style=3D"width: 300p= x; overflow: hidden;"> <a href=3D"https://click1.e.hw-commercialdesign.com/gwcjlgsmcytdntkgdkqtgds= ttsdtynkjfcrcpflckltcly_mpttywwpcdlcdscsyydww.html" xt=3D"SPCLICK" name=3D"= nnn31" style=3D"color:#000 !important; text-decoration: none !important;"= data-cms-ai=3D"0"><img src=3D"https://cdnassets.hw.net/dims4/GG/3c6ad7c/21= 47483647/thumbnail/300x200%3E/quality/90/?url=3Dhttps%3A%2F%2Fcdnassets.hw.= net%2Fb2%2F3e%2Fd88af2dd4b0abb71a26c7dadac11%2Funtitled-1.jpg" width=3D"300= " height=3D"200" border=3D"0" alt=3D"This Week in Tech & Culture: IKEA's=20= Bio-based Glues, Waste-free 3D-printed Concrete Walls, and Real-time Flood= Data with AI and Google" data-size=3D"promo_300x200"></a> =20= </div> </td> <td style=3D"border-collapse: collapse; mso-table-lspac= e: 0pt; mso-table-rspace: 0pt;"> <table class=3D"img-spacer" width=3D"12" align=3D"c= enter" style=3D"width: 12px; height: 0;"> <tr> <td> </td> </tr> </table> </td> <td class=3D"mobileColToRow" width=3D"303" colspan=3D"1= " rowspan=3D"1" valign=3D"top" style=3D"clear: both; padding-left: 0; "> <table width=3D"100%"> <tbody> <tr> <td class=3D"eyebrow" style=3D"color:= #ed1f24; padding-bottom: 5px;"> <p style=3D"display: inline-block= !important; color: #ed1f24 !important; margin-top: 0; margin-bottom: 0 !im= portant; font-size: 0.7em; font-weight: bold; text-transform: uppercase;"> <span style=3D"display: inline-= block; color: #ed1f24;"> Technology </span> </p> </td> </tr> <tr> <td style=3D"color: #000000 !important;= "> <h2 style=3D"display: inline-block= !important; color: #000000; margin-top: 0; margin-bottom: 0 !important;=20= font-size: 1.4em; font-weight: bold; line-height: 1.1em;"> <a href=3D"https://click1.e.hw-commercialdesign.com/hnqlhbjfvqwzmwsbzsrwbzj= wwjzwqmsldvcvpdhvshwvhb_mpttywwpcdlcdscsyydww.html" xt=3D"SPCLICK" name=3D"= nnn32" style=3D"color: #000000 !important; text-decoration: none !important= ;" data-cms-ai=3D"0"> <span= style=3D"color: #000000; text-decoration: none;"> This Week in Tech & Cul= ture: IKEA's Bio-based Glues, Waste-free 3D-printed Concrete Walls, and Rea= l-time Flood Data with AI and Google </span> </a> </h2> </td> </tr> <tr> <td style=3D"color: #6c6c6c !important;= "> <p style=3D"margin-top: 0; margin-b= ottom: 0 !important; font-size: 0.9em; color: #6c6c6c !important; line-heig= ht: 1.5em;"> <span style=3D"color: #6c6c6c;"= > Plus, an eco-conscious, 119-= year-old Tudor; the hyper recycling and repurposing of building materials;= the history of solar power in the U.S.; and… </span> <a href=3D"https://click1.e.hw-commercialdesign.com/ktmbdmwplhsjfsrmjrksmjw= sswjshfrbzlvlqzdlrdsldr_mpttywwpcdlcdscsyydww.html" xt=3D"SPCLICK" name=3D"= nnn33" style=3D"display: inline-block !important; color: #00aeed !important= ; text-decoration: none !important;" class=3D"moreLink" data-cms-ai=3D"0">= <span class=3D"moreLink" style=3D"display: inl= ine-block; color: #00aeed; text-decoration: none; text-transform: uppercase= ;"> Read More </span> </a> </p> </td> </tr> </tbody> </table> </td> </tr> </tbody> </table> </td> </tr> <tr> <td height=3D"18"> </td> </tr> <tr> <td width=3D"100%" colspan=3D"3" style=3D"border-collapse: collapse; mso-table-lspace: 0pt; mso-tabl= e-rspace: 0pt;"> <table width=3D"100%" cellspacing=3D"0" cellpadding=3D"0"> <tbody> <tr> <td class=3D"mobileColToRow extra-padding" width=3D"300= " valign=3D"top" style=3D"padding-left: 0; width: 300px;"> <div class=3D"mobileThumbnail" style=3D"width: 300p= x; overflow: hidden;"> <a href=3D"https://click1.e.hw-commercialdesign.com/lzdfwgshmknrqndgrdpngrs= nnsrnkqdflmjmclwmdwnmwj_mpttywwpcdlcdscsyydww.html" xt=3D"SPCLICK" name=3D"= nnn34" style=3D"color:#000 !important; text-decoration: none !important;"= data-cms-ai=3D"0"><img src=3D"https://cdnassets.hw.net/dims4/GG/6bcec65/21= 47483647/thumbnail/300x200%3E/quality/90/?url=3Dhttps%3A%2F%2Fcdnassets.hw.= net%2F8f%2F43%2Ff43163754f0fa05bf8ea3506084d%2Fgad-hero.jpg" width=3D"300"= height=3D"200" border=3D"0" alt=3D"GAD Cuts Ribbon on First Office in the= United States" data-size=3D"promo_300x200"></a> </d= iv> </td> <td style=3D"border-collapse: collapse; mso-table-lspac= e: 0pt; mso-table-rspace: 0pt;"> <table class=3D"img-spacer" width=3D"12" align=3D"c= enter" style=3D"width: 12px; height: 0;"> <tr> <td> </td> </tr> </table> </td> <td class=3D"mobileColToRow" width=3D"303" colspan=3D"1= " rowspan=3D"1" valign=3D"top" style=3D"clear: both; padding-left: 0; "> <table width=3D"100%"> <tbody> <tr> <td class=3D"eyebrow" style=3D"color:= #ed1f24; padding-bottom: 5px;"> <p style=3D"display: inline-block= !important; color: #ed1f24 !important; margin-top: 0; margin-bottom: 0 !im= portant; font-size: 0.7em; font-weight: bold; text-transform: uppercase;"> <span style=3D"display: inline-= block; color: #ed1f24;"> Press Release </span> </p> </td> </tr> <tr> <td style=3D"color: #000000 !important;= "> <h2 style=3D"display: inline-block= !important; color: #000000; margin-top: 0; margin-bottom: 0 !important;=20= font-size: 1.4em; font-weight: bold; line-height: 1.1em;"> <a href=3D"https://click1.e.hw-commercialdesign.com/wfgtnvkjdlsbzswvbwqsvbk= sskbslzwthdgdmhndwnsdns_mpttywwpcdlcdscsyydww.html" xt=3D"SPCLICK" name=3D"= nnn35" style=3D"color: #000000 !important; text-decoration: none !important= ;" data-cms-ai=3D"0"> <span= style=3D"color: #000000; text-decoration: none;"> GAD Cuts Ribbon on Firs= t Office in the United States </span> </a> </h2> </td> </tr> <tr> <td style=3D"color: #6c6c6c !important;= "> <p style=3D"margin-top: 0; margin-b= ottom: 0 !important; font-size: 0.9em; color: #6c6c6c !important; line-heig= ht: 1.5em;"> <span style=3D"color: #6c6c6c;"= > Founded by Gokhan Avcioglu= in 1994, the international firm Global Architecture and Design has opened= its first U.S. office in New York. </span> <a href=3D"https://click1.e.hw-commercialdesign.com/wfstnvkjdlsbzswvbwqsvbk= sskbslzwthdgdmhndwnsdnn_mpttywwpcdlcdscsyydww.html" xt=3D"SPCLICK" name=3D"= nnn36" style=3D"display: inline-block !important; color: #00aeed !important= ; text-decoration: none !important;" class=3D"moreLink" data-cms-ai=3D"0">= <span class=3D"moreLink" style=3D"display: inl= ine-block; color: #00aeed; text-decoration: none; text-transform: uppercase= ;"> Read More </span> </a> </p> </td> </tr> </tbody> </table> </td> </tr> </tbody> </table> </td> </tr> <tr> <td height=3D"18"> </td> </tr> =09=09=09=09=09=09=09 <tr> <td width=3D"600" valign=3D"top" align=3D"center" style=3D"padding-bottom: 20px; border-bottom: 3px solid #000;"></td= > </tr> <tr> <td height=3D"10"> </td> </tr><tr> <td style=3D"color: #000000 !important;"><h2 style=3D"displ= ay: inline-block !important; color: #000000; margin-top: 0; margin-bottom:= 0 !important; font-size: 1.0em; font-weight: bold; line-height: 1.1em;">= <span style=3D"color: #ed1f24; text-decoration: none;"> Upcoming Events:= </span></h2></td> </tr> <tr> <td height=3D"10"> </td> </tr> <tr> <td style=3D"color: #000000 !important;= "> <h2 style=3D"display: inline-block= !important; color: #000000; margin-top: 0; margin-bottom: 0 !important;=20= font-size: .9em; font-weight: bold; line-height: 1.1em;"> <a href=3D"https://click1.e.hw-commercialdesign.com/qnpjpsydmwfthfvstvqfsty= ffytfwhvjcmgmrcpmvpfmph_mpttywwpcdlcdscsyydww.html" name=3D"nnn50" style=3D= "color: #000000 !important; text-decoration: none !important;" data-cms-ai= =3D"0"> <span style=3D"color= : #000000; text-decoration: none;"> The Environmental Impact= s of Building Materials =E2=80=93 Comparing Concrete, Wood, and Steel</a>= — Apr 20, 2023 | Live Online </span> </a> </h2> </td> </tr> <tr> <td style=3D"color: #6c6c6c !important;= "> <p style=3D"margin-top: 0; margin-b= ottom: 0 !important; font-size: 0.8em; color: #6c6c6c !important; line-heig= ht: 1.5em;"> <span style=3D"color: #6c6c6c;"= > The presentation will address= critical issues the design professional should consider when evaluating=20= the environmental impacts of building materials to maximize performance and= deliver lasting value. </span> <h2 style=3D"display:= inline-block !important; color: #000000; margin-top: 0; margin-bottom: 0= !important; font-size: 0.8em; font-weight: bold; line-height: 1.1em;"><a= href=3D"https://click1.e.hw-commercialdesign.com/zzdgwpvfrmlkdlbpkbjlpkvll= vklmdbgcrsrqcwrbwlrwf_mpttywwpcdlcdscsyydww.html" name=3D"nnn51" style=3D"c= olor: #000000 !important; text-decoration: none !important;" data-cms-ai=3D= "0"> <span class=3D"moreLink= " style=3D"display: inl= ine-block; color: #00aeed; text-decoration: none; text-transform: uppercase= ;">Register Now</span> </a></h2></td> </tr> <tr> <td height=3D"18"> </td> </tr> <tr> <td style=3D"color: #000000 !important;= "> <h2 style=3D"display: inline-block= !important; color: #000000; margin-top: 0; margin-bottom: 0 !important;=20= font-size: .9em; font-weight: bold; line-height: 1.1em;"> <a href=3D"https://click1.e.hw-commercialdesign.com/cphkjpvmtdlfqlgpfgrlpfv= llvfldqgkstctzsjtgjltqh_mpttywwpcdlcdscsyydww.html" name=3D"nnn52" style=3D= "color: #000000 !important; text-decoration: none !important;" data-cms-ai= =3D"0"> <span style=3D"color= : #000000; text-decoration: none;"> Architect Connections</a= > — Jun 5-6, 2023 | Beacon Grand, San Francisco, CA=20 </span> </a> </h2> </td> </tr> <tr> <td style=3D"color: #6c6c6c !important;= "> <p style=3D"margin-top: 0; margin-b= ottom: 0 !important; font-size: 0.8em; color: #6c6c6c !important; line-heig= ht: 1.5em;"> <span style=3D"color: #6c6c6c;"= > <b>Grow Your Network at Archi= tect Connections</b><br/>Get matched through double opt-in meetings this=20= June. Find your next partner, client, supplier, or solution provider. YOU= set the agenda, ask the questions… </span> <h2 style=3D"display:= inline-block !important; color: #000000; margin-top: 0; margin-bottom: 0= !important; font-size: 0.8em; font-weight: bold; line-height: 1.1em;"><a= href=3D"https://click1.e.hw-commercialdesign.com/lgmfwgshmknrqndgrdpngrsnn= srnkqdflmjmclwmdwnmqm_mpttywwpcdlcdscsyydww.html" name=3D"nnn53" style=3D"c= olor: #000000 !important; text-decoration: none !important;" data-cms-ai=3D= "0"> <span class=3D"moreLink= " style=3D"display: inl= ine-block; color: #00aeed; text-decoration: none; text-transform: uppercase= ;">Register Now</span> </a></h2></td> </tr> =20 =20 =09=09=09=09=09=09 =09=09=09=09=09=09 =09=09=09=09=09 =20 =09=09=09=09=09=09=09 =09=09=09=09=09=09<tr> <td width=3D"600" valign=3D"top" align=3D"center" style=3D"padding-bottom: 20px; border-bottom: 3px solid #000;"></td= > </tr> </tr> =20 </tr> =20 =20 =09=09=09=09=09=09=09 =09=09=09=09=09 =20 =09=09=09=09=09 =20 =09=09=09=09=09=09=09 =09=09=09=09=09=09=09 </tr> =20 =20 =09=09=09=09=09=09=09 =09=09=09=09=09 =20 =09=09=09=09=09 =20 =09=09=09=09=09=09=09 =09=09=09=09=09=09=09 </tr> =20 <tr> <td class=3D"mobileSpecialLinks" width=3D"600" style=3D"padding-top:=20= 10px; padding-bottom: 20px;" valign=3D"top"> <span style=3D"margin-top: 0; margin-right: 0; margin-bottom: 0;=20= margin-left: 0; padding-top: 0; padding-right: 0; padding-bottom: 0; paddin= g-left: 0; list-style-type: none;"> =20 =20 <span class=3D"" style=3D"margin-left: 0;"> <a href=3D"https://click1.e.hw-commercialdesign.com/kmhbdmwplhsjfsrmjrksmjw= sswjshfrbzlvlqzdlrdslfh_mpttywwpcdlcdscsyydww.html" name=3D"nnn56" style=3D= "color: #ed1f24 !important; text-decoration: none !important;" class=3D"sp= ecial-link" target=3D"_blank" data-cms-ai=3D"0"> <span= class=3D"special-link" style=3D"color: #ed1f24 !important; font-size:= 1.0em !important;"> Advertise </span> </a> =20 <br /> <span class=3D"" style=3D"margin-left: 0;"> <a href=3D"https://click1.e.hw-commercialdesign.com/pjjrcjwvhqlbdlyjbytljbw= llwblqdyrghmhkgchyclhdj_mpttywwpcdlcdscsyydww.html" name=3D"nnn57" style=3D= "color: #ed1f24 !important; text-decoration: none !important;" class=3D"sp= ecial-link" target=3D"_blank" data-cms-ai=3D"0"> <span= class=3D"special-link" style=3D"color: #ed1f24 !important; font-size:= 1.0em !important;"> Contact Us </span> </a> =20 =20 </td> </tr> <tr> =20 <table align=3D"center" width=3D"100%" border=3D"0" cellspacing=3D"= 0" cellpadding=3D"0"> <tr> <td> <p style=3D"text-align: center; margin-top: 0; margin-b= ottom: 5px !important; font-size: 1.25em; font-weight: bold; font-style:=20= italic;"> Follow Us </p> </td> </tr> <tr> <td style=3D"text-align: center; padding-left: 5px; padding= -right: 5px;"> <span style=3D"display: inline-block;"> <a name=3D"" style=3D"text-decoration: none;"= href=3D"https://click1.e.hw-commercialdesign.com/pjyrcjwvhqlbdlyjbytljbwll= wblqdyrghmhkgchyclhdy_mpttywwpcdlcdscsyydww.html" data-cms-ai=3D"0"> <img src=3D"https://cdnassets.hw.net/91/86/377e5fc44ee487474f8ce468e54e/twi= tter-social-icon-circle-resize.png" width=3D"35" height=3D"35" border=3D"0"= > </a> </span> <span> </span> <span style=3D"display: inline-block;"> <a name=3D"" style=3D"text-decoration: none;"= href=3D"https://click1.e.hw-commercialdesign.com/fhjcghtydsnwrnbhwbznhwtnn= twnsrbcpdjdlpgdbgndrj_mpttywwpcdlcdscsyydww.html" data-cms-ai=3D"0"> <img src=3D"https://cdnassets.hw.net/51/b1/8422958f420fa89dec46e141ef33/fac= ebook-resize.png" width=3D"35" height=3D"35" border=3D"0"> =20= </a> </span> <span> </span> <span style=3D"display: inline-block;"> <a name=3D"" style=3D"text-decoration: none;"= href=3D"https://click1.e.hw-commercialdesign.com/vpgqjpdyfvgnmgkpnkbgpndgg= dngvmkqcfhfzcjfkjgfmg_mpttywwpcdlcdscsyydww.html" data-cms-ai=3D"0"> <img src=3D"https://cdnassets.hw.net/39/2f/1a3453ae432b833ad88dee73260d/lin= kedin-resize.png" width=3D"35" height=3D"35" border=3D"0"> =20= </a> </span> <span> </span> <span style=3D"display: inline-block;"> <a name=3D"" style=3D"text-decoration: none;"= href=3D"https://click1.e.hw-commercialdesign.com/rnthtnylcrvpwvknpkfvnpyvv= ypvrwkhscgcbstcktvcwt_mpttywwpcdlcdscsyydww.html" data-cms-ai=3D"0"> <img src=3D"https://cdnassets.hw.net/dd/11/e9739a9547fca36c636a7fba9279/ins= tagram-resize.png" width=3D"35" height=3D"35" border=3D"0"> =20= </a> </span> <span> </span> <span style=3D"display: inline-block;"> <a name=3D"" style=3D"text-decoration: none;"= href=3D"https://click1.e.hw-commercialdesign.com/rnwhtnylcrvpwvknpkfvnpyvv= ypvrwkhscgcbstcktvcww_mpttywwpcdlcdscsyydww.html" data-cms-ai=3D"0"> <img src=3D"https://cdnassets.hw.net/f3/05/5205782847ab99e767d07c999f52/pin= terest-resize.png" width=3D"35" height=3D"35" border=3D"0"> =20= </a> </span> =20 </td> </tr> </table> </td> </tr> <tr> <td width=3D"600" style=3D"padding-top: 15px; text-align: center; clear= : both;"> =20 =20 <span style=3D"padding-bottom: 10px; font-family: Arial, Helvet= ica, sans-serif; font-size: 1.0em;"> <a href=3D"https://click1.e.hw-commercialdesign.com/eyqvzyjqrshfphtyftlhyfj= hhjfhsptvcrbrwczrtzhrpq_mpttywwpcdlcdscsyydww.html" name=3D"nnn64" style=3D= "text-decoration: underline !important; color: #00aeed !important;" target= =3D"_blank" data-cms-ai=3D"0">AIA</a> =20 </span> </td> </tr> <tr> <td style=3D"height: 5px; line-height: 0; overflow: hidden; clear: both= ;"> =20 </td> </tr> <tr> <td width=3D"615" style=3D"padding-top: 10px; padding-bottom: 10px; tex= t-align: center; clear: both;"> <p style=3D"margin-top: 0; margin-botto= m:10px; font-size: 0.6em; color: #777 !important;">=20 To make sure you continue to receive our e-mails in your inbox (not in your= bulk or junk folders), please add architectnewswire@e.hw-commercialdesign.= com to your address book or safe sender list. </p> =20 =20 <p style=3D"margin-top: 0; margin-bottom:10px;= font-size: 0.6em; color: #777 !important;"> <a href=3D"https://click1.e.hw-commercialdesign= =2Ecom/apmvtdrlmkpnspydnyzpdnrpprnpksyvcmhmgctmytpmlb_mpttywwpcdlcdscsyydww= =2Ehtml?a=3Delvis%40ebaarchitects.org" style=3D"color:#00aeef !important;= text-decoration: none !important;" data-cms-ai=3D"0">Click Here</a> to uns= ubscribe from ARCHITECT Newswire.</p> <p style=3D"margin-top: 0; margin-bottom:10px; font-size: 0.6em; color: #77= 7 !important;"> =20 =20 =09=09 =20 =20 =09=09 <p style=3D"margin-top: 0; margin-bottom:0; font-= size: 0.6em; color: #777 !important;">=C2=A9 Zonda Media, a Delaware corpor= ation. All Rights Reserved. Republication or re-dissemination of this newsl= etter's content is expressly prohibited without the written permission of= <a href=3D"https://click1.e.hw-commercialdesign.com/bqlscfvzplqybqjfyjkqfy= vqqvyqlbjsnpgpmncpjcqpzp_mpttywwpcdlcdscsyydww.html">Zonda Media, a Delawar= e corporation.</a> </p><p style=3D"margin-top: 0; margin-bottom:0; font-siz= e: 0.6em; color: #777 !important;"> Zonda Media, a Delaware corporation | 1152 15th St. NW | Suite 850 | Washin= gton, DC 20005-5811</p> =09=09=09=09=09=09=09 </td> </tr> </table> </td> </tr> </table> <style type=3D"text/css"> /* Forces Outlook.com to display emails at full width */ .ExternalClass, .ExternalClass p, .ExternalClass span, .ExternalClass= font, .ExternalClass td, .ExternalClass div { line-height: 100%; } .ReadMsgBody { width: 100%; } .ExternalClass { width: 100%; line-height: 100%; } .ExternalClass p { margin-bottom: 0 !important; } /* Override AOL defaults */ body {font-family:Helvetica, Arial, sans-serif;font-size:12pt;margin:= 0;} th {font-size:12pt;} td {color: #6c6c6c;} td.eyebrow p a= [href]= { color: #ed1f24 !important; } /*Yahoo adds span.yshortcuts inside all links*/ a:link, span.yshortcuts { color: #000; /* Link color must be set inline for Gmail*/ background-color: none; border: none; text-decoration: none; } /* Overrides Outlook.com Contextual Highlighting */ span { color: #6c6c6c; border-bottom-width: 0; border-bottom-style: none; } p a:link, p span.yshortcuts { text-decoration: underline; } p a:active, p a:visited, p span.yshortcuts:active { text-decoration: underline; } a:active, a:visited, span.yshortcuts:active { color: #000; background-color: none; border: none; text-decoration: none; } a:hover, span.yshortcuts:hover, span.yshortcuts:focus { text-decoration: underline; } a.special-link, span.special-link { color: #f01e27 !important; text-decoration: none !important; } a.moreLink, span.moreLink, p a= [href]= { color: #00aeed !important; text-decoration: none !important; } h1 { color: #00aeed !important; text-decoration: none !important; } h1, h2, h3, h4, h5, h6, p, span { font-family: Arial, Helvetica, sans-serif; } h2, h4, h5 { color: #000 !important; /* Override Hotmail and Yahoo head tag colo= rs - Must also be set inline */ } h3 { color: #fff !important; } h6 { color: #777 !important; } .quote { color: #00adef !important; } p { margin-bottom: 0 !important; } .footertext { color: #777 !important; } table { border-collapse: collapse; } .MsoNormal { padding-bottom: 0 } /* =3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D= =3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D= =3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D= =3D=3D Mobile =3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D= =3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D= =3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D= =3D=3D */ table= [class=3D"mobileWrapper"]= { width: 650px !important; } table= [class=3D"mobileContent"]= { width: 615px !important; background-color: #ffffff !important; } table= [class=3D"mobileContent"]= td= [class=3D"50-50"]= > table { /*width: 300px !important;*/ max-width: 100% !important; } /*table= [class=3D"mobileContent"]= td= [class=3D"50-50"]= table= [align=3D"left"]= td{ padding-right: 12px !important; }*/ table.mobileContent td.mobileLogo { display: block !important; } table.mobileContent tr.mobileMobileLogo { display: none !important; text-align: left; } table.mobileContent td.mobileSocial img { margin: 0 !important; } table.mobileContent td.mobileSocial td { display: inline-block !important; width: auto !important; } table.mobileContent td.mobileAdwrapper img { border-style: none !important; } table.mobileContent td.extra-padding { padding-top: 5px !important; padding-bottom: 5px !important; } table.mobileContent td.extra-padding-bottom{ padding-bottom:18px !important; } @media only screen and (max-width: 614px) { table= [class=3D"mobileWrapper"]= { display: block !important; width: 350px !important; height: auto !important; padding: 0 15px !important } table= [class=3D"mobileContent"]= , table= [class=3D"mobileContent"]= table, table= [class=3D"mobileContent"]= thead, table= [class=3D"mobileContent"]= tbody, table= [class=3D"mobileContent"]= tfoot, table= [class=3D"mobileContent"]= th, table= [class=3D"mobileContent"]= td, table= [class=3D"mobileContent"]= tr, table= [class=3D"mobileContent"]= div.mobileThumbnail { display: block !important; width: 100% !important; height: auto !important; } table= [class=3D"mobileContent"]= td= [class=3D"50-50"]= > table{ width: 100% !important; float: none !important; clear: both !important; margin: 0 auto !important; } table= [class=3D"mobileContent"]= table= [class=3D"img-spacer"]= { display: none !important; } table= [class=3D"mobileContent"]= td= [class=3D"50-50"]= > table= [class=3D"spacer"]= { width: 100% !important; height: 10px !important; } table= [class=3D"mobileContent"]= td= [class=3D"50-50"]= > table td= [class=3D"mobileAdwrapper"]= { text-align: center !important; } table= [class=3D"mobileContent"]= td= [class=3D"50-50"]= table= [align=3D"left"]= td{ padding-right: 0 !important; } table= [class=3D"mobileContent"]= h3 { min-height: 12px !important; height: auto !important; width: 100% !important; } table= [class=3D"mobileContent"]= .mobileLogo { height: auto; } table= [class=3D"mobileContent"]= td.mobileAdwrapper { padding-left: 0 !important; text-align: center !important; } table= [class=3D"mobileContent"]= div.mobileThumbnail { display: block !important; width: 300px !important; max-height: 200px !important; height: auto !important; overflow: hidden !important; margin: 0 auto; } table= [class=3D"mobileContent"]= div.mobileThumbnail img { width: 300px !important; height: auto !important; } table= [class=3D"mobileContent"]= .mobileLogoImg { width: 300px !important; height: auto !important; } table= [class=3D"mobileContent"]= .mobileLeaderboardAd { padding-left: 0 !important; padding-right: 0 !important; } table= [class=3D"mobileContent"]= .mobileLeaderboardAd div { width: 100% !important; } table= [class=3D"mobileContent"]= .mobileLeaderboardAd img { width: 100% !important; height: auto !important; } table= [class=3D"mobileContent"]= .colSeparator { display: none; } table= [class=3D"mobileContent"]= .mobileDate { border-top: none !important; height: 35px; } table= [class=3D"mobileContent"]= .mobileSpecialLinks td { padding-top: 0 !important; padding-bottom: 20px !important; } table= [class=3D"mobileContent"]= .mobileSpecialLinks ul { font-size: 0; text-align: center; } table= [class=3D"mobileContent"]= .mobileSpecialLinks li { /*padding-right: 25px;*/ font-size: 15px; display: inline-block; } table= [class=3D"mobileContent"]= .mobileSpecialLinks li.mobileFirstChild { /*padding-right: 0px;*/ float: left; } table= [class=3D"mobileContent"]= .mobileSpecialLinks li.mobileLastChild { /*padding-right: 0px;*/ float: right; } table= [class=3D"mobileContent"]= .mobileSpecialLinks li.mobileArrow { background-image: url('http://images.hanleywood.com/newsletters= /arrow-right.png'); width: 14px; height: 14px; float: left; margin-right: 2px; } table= [class=3D"mobileContent"]= .mobileSpecialLinks li.mobileArrow img { display: none; } table= [class=3D"mobileContent"]= .mobileMagazine { float: left; width: 145px; padding-right: 10px; border-bottom: none !important; } table= [class=3D"mobileContent"]= .mobileMagazine div { border-bottom: none !important; } table= [class=3D"mobileContent"]= .mobileMagImg, table= [class=3D"mobileContent"]= .mobileMagImg img { width: 145px !important; height: auto !important; } table= [class=3D"mobileContent"]= .mobilePublicationLinks { float: left; width: 145px; } table= [class=3D"mobileContent"]= .mobilePublicationLinks + tr { clear: both; } table= [class=3D"mobileContent"]= .mobileColToRow { margin-bottom: 10px; } table= [class=3D"mobileContent"]= .mobileSocialIcons { width: 100% border-top: 2px solid #000; height: 34px; padding: 2px 0 !important; } table= [class=3D"mobileContent"]= td.mobileSocial { padding-bottom: 5px; } /* mobile hacks for the current issue before footer */ table= [class=3D"mobileContent"]= tr.mobileMobileLogo td > div { width: 100% !important; overflow: auto !important; height: auto !important; line-height: normal !important; } table= [class=3D"mobileContent"]= tr.mobileMobileLogo { display: block !important; } table= [class=3D"mobileContent"]= tr.mobileMobileLogo td > div { display: block !important; height: auto !important; width: auto !important; } table= [class=3D"mobileContent"]= .utilityLinks a.special-link span.special-link { font-size: 0.6em !important; } table= [class=3D"mobileContent"]= td.mobileSocial img { display: inline-block !important; } table= [class=3D"mobileContent"]= td.extra-padding { padding-top: 0px !important; padding-bottom: 0px !important; } table= [class=3D"mobileContent"]= .zero-height { height: 0px !important; } table= [class=3D"mobileContent"]= div.mobileImage { width: 300px !important; overflow: hidden !important; height: 200px !important; } table= [class=3D"mobileContent"]= div.mobileImage img { width: 300px !important; height: auto !important; } table= [class=3D"mobileContent"]= span#mobileChart { display: block; width: 300px !important; height: 200px !important; } table= [class=3D"mobileContent"]= .colSeparator { display: none; } table= [class=3D"mobileContent"]= .mobileLeftCol { display: inline-block; } table= [class=3D"mobileContent"]= .mobileRightCol { width: 80px !important; float: right; } table= [class=3D"mobileContent"]= .mobileLogo td { display: table-cell; } table= [class=3D"mobileContent"]= .mobileHeader img { max-width: 300px; height: auto; } table= [class=3D"mobileContent"]= .mobileHeader, table= [class=3D"mobileContent"]= .mobileHeader table, table= [class=3D"mobileContent"]= .mobileHeader td { height: auto !important; } table= [class=3D"mobileContent"]= .mobileHeader table { margin-top: 5px !important; margin-bottom: 5px !important; } table= [class=3D"mobileContent"]= .mobileHeaderAd, table= [class=3D"mobileContent"]= .mobileHeaderAd table, table= [class=3D"mobileContent"]= .mobileHeaderAd tbody, table= [class=3D"mobileContent"]= .mobileHeaderAd td, table= [class=3D"mobileContent"]= .mobileHeaderAd tr, table= [class=3D"mobileContent"]= .mobileHeaderAd h6 { width: 80px !important; } table= [class=3D"mobileContent"]= .mobileHeaderAd h6 { font-size: .55em !important; -webkit-text-size-adjust: none; -moz-text-size-adjust: none; -ms-text-size-adjust: none; } table= [class=3D"mobileContent"]= .mobileHeaderAd { ] border: none !important; position: absolute; top: -40px; } table= [class=3D"mobileContent"]= .mobileHeaderAd img { max-width: 80px; height: auto; } table= [class=3D"mobileContent"]= .mobileFooterAd img { width: 300px !important; height: auto !important; } td= [id=3D"mobileHideMagazineIssue"]= { display: none !important;=20 } table= [id=3D"mobileRelative"]= { position: relative !important; top: 50px !important; } } </style> <img src=3D"https://ccd190.efeedbacktrk.com/pdqrcjwvhqlbdlyjbytljbwllwblqdy= rghmhkgchyclhjc_mpttywwpcdlcdscsyydww.gif" width=3D"0" height=3D"0" alt=3D"= "> <span style=3D"display: none;"><a href=3D'https://click1.e.hw-commercial= design.com/tchdmhsplzckjcbhkbfchksccskczjbdtlvlrtmlbmclpz_mpttywwpcdlcdscsy= ydww.html?a=3DA73B9126-8643-4D63-B66B-6284AE151CE7&b=3Dizvbvggcyd'>Link</a>= </span> </body> </html>