OwlCyberSecurity - MANAGER
Edit File: 1683738247.M852894P4176351.server237.web-hosting.com,S=114263,W=117537
Return-Path: <bounce-mnqtywwpcdldycwclcdsybyttwwlzbympcqd@communication.hanleywood.com> Delivered-To: elvis@ebaarchitects.org Received: from server237.web-hosting.com by server237.web-hosting.com with LMTP id aBdnMofOW2TfuT8A7Ypugw (envelope-from <bounce-mnqtywwpcdldycwclcdsybyttwwlzbympcqd@communication.hanleywood.com>) for <elvis@ebaarchitects.org>; Wed, 10 May 2023 13:04:07 -0400 Return-path: <bounce-mnqtywwpcdldycwclcdsybyttwwlzbympcqd@communication.hanleywood.com> Envelope-to: elvis@ebaarchitects.org Delivery-date: Wed, 10 May 2023 13:04:07 -0400 Received: from mail4.communication.hanleywood.com ([96.46.128.145]:34784) by server237.web-hosting.com with esmtps (TLS1.2) tls TLS_ECDHE_RSA_WITH_AES_256_GCM_SHA384 (Exim 4.95) (envelope-from <bounce-mnqtywwpcdldycwclcdsybyttwwlzbympcqd@communication.hanleywood.com>) id 1pwnEP-000AYD-KB for elvis@ebaarchitects.org; Wed, 10 May 2023 13:04:07 -0400 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; s=class; d=e.hw-commercialdesign.com; h=Date:From:Reply-To:To:Message-ID:Subject:MIME-Version:Content-Type: Content-Transfer-Encoding:List-Unsubscribe; i=architectnewswire@e.hw-commercialdesign.com; bh=azN/TBNT5xTuzehdpoe/2/Vc0gUdfytk0ZBmhWSBYH4=; b=uRmK4E8nhScJ+5dweWr4wGfE/6Kd6abW+o1WOx/MMZzva5Ncf5w448F4nZIO+PUWDAP3hm8d9SVC lLdWpcWQXL5EptYN4U2nzZKa2FgxgJOKKjr6th0BiNJKC78tV5u2T//gfXsaWKo0jbZT8wtSm1CR JZ9dkNwqYs3msw9UENY= DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; s=class; d=communication.hanleywood.com; h=Date:From:Reply-To:To:Message-ID:Subject:MIME-Version:Content-Type: Content-Transfer-Encoding:List-Unsubscribe; bh=azN/TBNT5xTuzehdpoe/2/Vc0gUdfytk0ZBmhWSBYH4=; b=G+Thootwxo8HbHd8N6et1gCFTFrI6TfPm29EUl4N/EThMw5nOMnimsJVE1q0Imx1DCX2OLLGb4et jRu149BILUxcNa46PAHqY+ypfTdV2s8DobrIcZI/GDCY/hmenUbbsaIARBSXYKcKA1GVPMqmqS2Q fFF0RIp08bEcf0l8URk= Received: by mail4.communication.hanleywood.com id hbf75g2uaicf for <elvis@ebaarchitects.org>; Wed, 10 May 2023 12:03:20 -0500 (envelope-from <bounce-mnqtywwpcdldycwclcdsybyttwwlzbympcqd@communication.hanleywood.com>) Date: Wed, 10 May 2023 12:03:20 -0500 (CDT) From: Architect Newswire <architectnewswire@e.hw-commercialdesign.com> Reply-To: Hanley Wood <updates@communication.hanleywood.com> To: friend <elvis@ebaarchitects.org> Message-ID: <268564817.8122516.1683738200156@communication.hanleywood.com> Subject: A Recent Report Shows Building Decarbonization Successes MIME-Version: 1.0 Content-Type: text/html; charset=UTF-8 Content-Transfer-Encoding: quoted-printable X-HANW: iybmvbdybmdvwyhywhbyghmgcz tnvpcyhdzdbvbkdvpddpdhzbtrymyqrnwbvggcydwdvygywydzvnvbbgg nnmdvcddy List-Unsubscribe: <mailto:unsub-4300916-63101-A73B912686434D63B66B6284AE151CE7@communication.hanleywood.com> X-Spam-Status: No, score=0.4 X-Spam-Score: 4 X-Spam-Bar: / X-Ham-Report: Spam detection software, running on the system "server237.web-hosting.com", has NOT identified this incoming email as spam. The original message has been attached to this so you can view it or label similar future email. If you have any questions, see root\@localhost for details. Content preview: Architect Newswire When Faced With Dwindling Downtowns, Architects Can Support Growth from Within Universal Hubs Content analysis details: (0.4 points, 5.0 required) pts rule name description ---- ---------------------- -------------------------------------------------- 0.0 URIBL_BLOCKED ADMINISTRATOR NOTICE: The query to URIBL was blocked. See http://wiki.apache.org/spamassassin/DnsBlocklists#dnsbl-block for more information. [URIs: efeedbacktrk.com] 0.2 HEADER_FROM_DIFFERENT_DOMAINS From and EnvelopeFrom 2nd level mail domains are different -0.0 SPF_PASS SPF: sender matches SPF record 0.1 URI_HEX URI: URI hostname has long hexadecimal sequence 0.0 HTML_MESSAGE BODY: HTML included in message 0.0 HTML_IMAGE_RATIO_04 BODY: HTML has a low ratio of text to image area 0.1 MIME_HTML_ONLY BODY: Message only has text/html MIME parts -0.1 DKIM_VALID_AU Message has a valid DKIM or DK signature from author's domain 0.1 DKIM_SIGNED Message has a DKIM or DK signature, not necessarily valid -0.1 DKIM_VALID Message has at least one valid DKIM or DK signature 0.0 T_KAM_HTML_FONT_INVALID Test for Invalidly Named or Formatted Colors in HTML -0.0 T_SCC_BODY_TEXT_LINE No description available. 0.0 LOTS_OF_MONEY Huge... sums of money X-Spam-Flag: NO =20 <!DOCTYPE html PUBLIC "-//W3C//DTD XHTML 1.0 Strict//EN" "http://www.w3= =2Eorg/TR/xhtml1/DTD/xhtml1-strict.dtd"> <html xmlns=3D"http://www.w3.org/1999/xhtml" xmlns:v=3D"urn:schemas-microsoft-com:vml" xmlns:o=3D"urn:schemas-microsoft-com:office:office"> <head profile=3D"http://www.w3.org/2005/10/profile"> <title>Architect Newswire</title> <meta http-equiv=3D"content-type" content=3D"charset=3Dutf-8"/> <meta http-equiv=3D"content-language" content=3D"en-us"/> <meta name=3D"viewport" content=3D"width=3Ddevice-width, initial-scale= =3D1.0, maximum-scale=3D2.0, user-scalable=3Dyes"/> <style type=3D"text/css"> /* Forces Outlook.com to display emails at full width */ .ExternalClass, .ExternalClass p, .ExternalClass span, .ExternalClass= font, .ExternalClass td, .ExternalClass div { line-height: 100%; } .ReadMsgBody { width: 100%; } .ExternalClass { width: 100%; line-height: 100%; } .ExternalClass p { margin-bottom: 0 !important; } /* Override AOL defaults */ body {font-family:Helvetica, Arial, sans-serif;font-size:12pt;margin:= 0;} th {font-size:12pt;} td {color: #6c6c6c;} td.eyebrow p a= [href]= { color: #ed1f24 !important; } /*Yahoo adds span.yshortcuts inside all links*/ a:link, span.yshortcuts { color: #000; /* Link color must be set inline for Gmail*/ background-color: none; border: none; text-decoration: none; } /* Overrides Outlook.com Contextual Highlighting */ span { color: #6c6c6c; border-bottom-width: 0; border-bottom-style: none; } p a:link, p span.yshortcuts { text-decoration: underline; } p a:active, p a:visited, p span.yshortcuts:active { text-decoration: underline; } a:active, a:visited, span.yshortcuts:active { color: #000; background-color: none; border: none; text-decoration: none; } a:hover, span.yshortcuts:hover, span.yshortcuts:focus { text-decoration: underline; } a.special-link, span.special-link { color: #f01e27 !important; text-decoration: none !important; } a.moreLink, span.moreLink, p a= [href]= { color: #00aeed !important; text-decoration: none !important; } h1 { color: #00aeed !important; text-decoration: none !important; } h1, h2, h3, h4, h5, h6, p, span { font-family: Arial, Helvetica, sans-serif; } h2, h4, h5 { color: #000 !important; /* Override Hotmail and Yahoo head tag colo= rs - Must also be set inline */ } h3 { color: #fff !important; } h6 { color: #777 !important; } .quote { color: #00adef !important; } p { margin-bottom: 0 !important; } .footertext { color: #777 !important; } table { border-collapse: collapse; } .MsoNormal { padding-bottom: 0 } /* =3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D= =3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D= =3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D= =3D=3D Mobile =3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D= =3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D= =3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D= =3D=3D */ table= [class=3D"mobileWrapper"]= { width: 650px !important; } table= [class=3D"mobileContent"]= { width: 615px !important; background-color: #ffffff !important; } table= [class=3D"mobileContent"]= td= [class=3D"50-50"]= > table { /*width: 300px !important;*/ max-width: 100% !important; } /*table= [class=3D"mobileContent"]= td= [class=3D"50-50"]= table= [align=3D"left"]= td{ padding-right: 12px !important; }*/ table.mobileContent td.mobileLogo { display: block !important; } table.mobileContent tr.mobileMobileLogo { display: none !important; text-align: left; } table.mobileContent td.mobileSocial img { margin: 0 !important; } table.mobileContent td.mobileSocial td { display: inline-block !important; width: auto !important; } table.mobileContent td.mobileAdwrapper img { border-style: none !important; } table.mobileContent td.extra-padding { padding-top: 5px !important; padding-bottom: 5px !important; } table.mobileContent td.extra-padding-bottom{ padding-bottom:18px !important; } @media only screen and (max-width: 614px) { table= [class=3D"mobileWrapper"]= { display: block !important; width: 350px !important; height: auto !important; padding: 0 15px !important } table= [class=3D"mobileContent"]= , table= [class=3D"mobileContent"]= table, table= [class=3D"mobileContent"]= thead, table= [class=3D"mobileContent"]= tbody, table= [class=3D"mobileContent"]= tfoot, table= [class=3D"mobileContent"]= th, table= [class=3D"mobileContent"]= td, table= [class=3D"mobileContent"]= tr, table= [class=3D"mobileContent"]= div.mobileThumbnail { display: block !important; width: 100% !important; height: auto !important; } table= [class=3D"mobileContent"]= td= [class=3D"50-50"]= > table{ width: 100% !important; float: none !important; clear: both !important; margin: 0 auto !important; } table= [class=3D"mobileContent"]= table= [class=3D"img-spacer"]= { display: none !important; } table= [class=3D"mobileContent"]= td= [class=3D"50-50"]= > table= [class=3D"spacer"]= { width: 100% !important; height: 10px !important; } table= [class=3D"mobileContent"]= td= [class=3D"50-50"]= > table td= [class=3D"mobileAdwrapper"]= { text-align: center !important; } table= [class=3D"mobileContent"]= td= [class=3D"50-50"]= table= [align=3D"left"]= td{ padding-right: 0 !important; } table= [class=3D"mobileContent"]= h3 { min-height: 12px !important; height: auto !important; width: 100% !important; } table= [class=3D"mobileContent"]= .mobileLogo { height: auto; } table= [class=3D"mobileContent"]= td.mobileAdwrapper { padding-left: 0 !important; text-align: center !important; } table= [class=3D"mobileContent"]= div.mobileThumbnail { display: block !important; width: 300px !important; max-height: 200px !important; height: auto !important; overflow: hidden !important; margin: 0 auto; } table= [class=3D"mobileContent"]= div.mobileThumbnail img { width: 300px !important; height: auto !important; } table= [class=3D"mobileContent"]= .mobileLogoImg { width: 300px !important; height: auto !important; } table= [class=3D"mobileContent"]= .mobileLeaderboardAd { padding-left: 0 !important; padding-right: 0 !important; } table= [class=3D"mobileContent"]= .mobileLeaderboardAd div { width: 100% !important; } table= [class=3D"mobileContent"]= .mobileLeaderboardAd img { width: 100% !important; height: auto !important; } table= [class=3D"mobileContent"]= .colSeparator { display: none; } table= [class=3D"mobileContent"]= .mobileDate { border-top: none !important; height: 35px; } table= [class=3D"mobileContent"]= .mobileSpecialLinks td { padding-top: 0 !important; padding-bottom: 20px !important; } table= [class=3D"mobileContent"]= .mobileSpecialLinks ul { font-size: 0; text-align: center; } table= [class=3D"mobileContent"]= .mobileSpecialLinks li { /*padding-right: 25px;*/ font-size: 15px; display: inline-block; } table= [class=3D"mobileContent"]= .mobileSpecialLinks li.mobileFirstChild { /*padding-right: 0px;*/ float: left; } table= [class=3D"mobileContent"]= .mobileSpecialLinks li.mobileLastChild { /*padding-right: 0px;*/ float: right; } table= [class=3D"mobileContent"]= .mobileSpecialLinks li.mobileArrow { background-image: url('http://images.hanleywood.com/newsletters= /arrow-right.png'); width: 14px; height: 14px; float: left; margin-right: 2px; } table= [class=3D"mobileContent"]= .mobileSpecialLinks li.mobileArrow img { display: none; } table= [class=3D"mobileContent"]= .mobileMagazine { float: left; width: 145px; padding-right: 10px; border-bottom: none !important; } table= [class=3D"mobileContent"]= .mobileMagazine div { border-bottom: none !important; } table= [class=3D"mobileContent"]= .mobileMagImg, table= [class=3D"mobileContent"]= .mobileMagImg img { width: 145px !important; height: auto !important; } table= [class=3D"mobileContent"]= .mobilePublicationLinks { float: left; width: 145px; } table= [class=3D"mobileContent"]= .mobilePublicationLinks + tr { clear: both; } table= [class=3D"mobileContent"]= .mobileColToRow { margin-bottom: 10px; } table= [class=3D"mobileContent"]= .mobileSocialIcons { width: 100% border-top: 2px solid #000; height: 34px; padding: 2px 0 !important; } table= [class=3D"mobileContent"]= td.mobileSocial { padding-bottom: 5px; } /* mobile hacks for the current issue before footer */ table= [class=3D"mobileContent"]= tr.mobileMobileLogo td > div { width: 100% !important; overflow: auto !important; height: auto !important; line-height: normal !important; } table= [class=3D"mobileContent"]= tr.mobileMobileLogo { display: block !important; } table= [class=3D"mobileContent"]= tr.mobileMobileLogo td > div { display: block !important; height: auto !important; width: auto !important; } table= [class=3D"mobileContent"]= .utilityLinks a.special-link span.special-link { font-size: 0.6em !important; } table= [class=3D"mobileContent"]= td.mobileSocial img { display: inline-block !important; } table= [class=3D"mobileContent"]= td.extra-padding { padding-top: 0px !important; padding-bottom: 0px !important; } table= [class=3D"mobileContent"]= .zero-height { height: 0px !important; } table= [class=3D"mobileContent"]= div.mobileImage { width: 300px !important; overflow: hidden !important; height: 200px !important; } table= [class=3D"mobileContent"]= div.mobileImage img { width: 300px !important; height: auto !important; } table= [class=3D"mobileContent"]= span#mobileChart { display: block; width: 300px !important; height: 200px !important; } table= [class=3D"mobileContent"]= .colSeparator { display: none; } table= [class=3D"mobileContent"]= .mobileLeftCol { display: inline-block; } table= [class=3D"mobileContent"]= .mobileRightCol { width: 80px !important; float: right; } table= [class=3D"mobileContent"]= .mobileLogo td { display: table-cell; } table= [class=3D"mobileContent"]= .mobileHeader img { max-width: 300px; height: auto; } table= [class=3D"mobileContent"]= .mobileHeader, table= [class=3D"mobileContent"]= .mobileHeader table, table= [class=3D"mobileContent"]= .mobileHeader td { height: auto !important; } table= [class=3D"mobileContent"]= .mobileHeader table { margin-top: 5px !important; margin-bottom: 5px !important; } table= [class=3D"mobileContent"]= .mobileHeaderAd, table= [class=3D"mobileContent"]= .mobileHeaderAd table, table= [class=3D"mobileContent"]= .mobileHeaderAd tbody, table= [class=3D"mobileContent"]= .mobileHeaderAd td, table= [class=3D"mobileContent"]= .mobileHeaderAd tr, table= [class=3D"mobileContent"]= .mobileHeaderAd h6 { width: 80px !important; } table= [class=3D"mobileContent"]= .mobileHeaderAd h6 { font-size: .55em !important; -webkit-text-size-adjust: none; -moz-text-size-adjust: none; -ms-text-size-adjust: none; } table= [class=3D"mobileContent"]= .mobileHeaderAd { ] border: none !important; position: absolute; top: -40px; } table= [class=3D"mobileContent"]= .mobileHeaderAd img { max-width: 80px; height: auto; } table= [class=3D"mobileContent"]= .mobileFooterAd img { width: 300px !important; height: auto !important; } td= [id=3D"mobileHideMagazineIssue"]= { display: none !important;=20 } table= [id=3D"mobileRelative"]= { position: relative !important; top: 50px !important; } } </style> </head> <body style=3D"background-color: #f2f3f5; color: #6c6c6c; font-size: 12pt;= margin-top: 0; margin-right: 0; margin-bottom: 0; margin-left: 0; padding-= top: 0; padding-right: 0; padding-bottom: 0; padding-left: 0;"> <table align=3D"center" width=3D"650" border=3D"0" cellspacing=3D"0" cellpa= dding=3D"0" class=3D"mobileWrapper" style=3D"width: 650px; margin-top: 0; margin-right: auto; margin-bot= tom: 0; margin-left: auto; padding: 0; font-family: Arial, Helvetica, sans-= serif; color: #6c6c6c; background-color: #fff;"> <tr> <td width=3D"615" style=3D"padding: 0; margin: 0; width: 615px;"> <table class=3D"mobileContent" id=3D"" width=3D"615" border=3D"= 0" cellspacing=3D"0" cellpadding=3D"0" align=3D"center" style=3D"margin-top: 0; margin-right: auto; margin-botto= m: 0; margin-left: auto; padding-top: 0; padding-bottom: 0;"> =20 <tr> <td style=3D"color: #6c6c6c !important;"> <p style=3D"margin-top: 0; margin-bottom: 20px !imp= ortant; font-size: 0.85em; color: #6c6c6c !important; "> <strong> <span style=3D"color:#6c6c6c !important;"> When Faced With Dwindling Downtowns, Archite= cts Can Support Growth from Within</span> </strong> </p> </td> </tr> <tr> <td align=3D"center" class=3D"mobileLeaderboardAd" width=3D"600" style=3D"padding-right: 6px; padding-top: 17px; padding-bottom: 3px= ; padding-left: 6px; text-align: center;"> <div style=3D"width: 600px; margin-right: auto; margin-left: auto;"= > <!--POWERINBOX 600x90--> <div class=3D"pi_17423 powerinbox"> <!-- domain: rs-stripe.architectmagazine.com --> <!--= [if (gte mso 9)|(IE)]= ><table align=3D"center" cellpadding=3D"0" cellspacing=3D"0" width=3D"600">= <tr><td><!= [endif]= --> <table width=3D"100%" border=3D"0" cellspacing=3D"0" cellpadding=3D"0"=20= style=3D"width: 100%; max-width: 600px;"> <tbody> <tr> <td width=3D"100%"> <a href=3D"https://click1.e.hw-commercialdesign.com/kddbdmwplhsjf= srmjrksmjwsswjshfrbzlvlqzdlrpmhhm_jrrtjssnbmwbmfjqjttss.html?a=3Delvis%40eb= aarchitects.org&b=3D63101" style=3D"border-style: none; outline: none; text= -decoration: none;" target=3D"_blank" ref=3D"nofollow"><img alt=3D"" height= =3D"auto" src=3D"https://rs-stripe.architectmagazine.com/stripe/image?cs_em= ail=3Delvis@ebaarchitects.org&cs_sendid=3D63101&cs_esp=3Dpostup&cs_offset= =3D0&cs_stripeid=3D17423&dfp_nl_send_date=3D05/09/2023" style=3D"width: 100= %; max-width: 600px;display: block; border: 0; height: auto; line-height:= 100%; outline: none; text-decoration: none;" width=3D"600"></a> </td> </tr> </tbody> </table> <!--= [if (gte mso 9)|(IE)]= ></td></tr></table><!= [endif]= --> </div> <!--POWERINBOX 600x90--> </div> </td> </tr> <tr> <td width=3D"100%" valign=3D"top" align=3D"center" height=3D"30" style= =3D"height: 30px;"> =20 </td> </tr> <tr> <td width=3D"100%" valign=3D"top" align=3D"center" style=3D"padding-bottom: 20px; border-bottom: 5px solid #000;"> <a href=3D"https://click1.e.hw-commercialdesign.com/pcdrcjwvhqlbdlyjbyt= ljbwllwblqdyrghmhkgchyvjqqy_jrrtjssnbmwbmfjqjttss.html" name=3D"" style=3D"= color: #000; text-decoration: none;" data-cms-ai=3D"0"> <img src=3D"https://cdnassets.hw.net/5b/f2/0fcd74f94927883a36c1c3aa7f4c/arc= hitect-newsletter-config.png" width=3D"341" height=3D"57" border=3D"0" vspa= ce=3D"8" alt=3D"Architect Newswire" style=3D"vertical-align: bottom; max-wi= dth: 456px; height: auto; margin-top: 0px; margin-bottom: 0" class=3D"mobil= eLogoImg"/> </a> </td> </tr> <tr> <td height=3D"18"> </td> </tr> <tr> <td width=3D"100%" valign=3D"top" class=3D"extra-paddin= g"> <table width=3D"100%" border=3D"0" cellspacing=3D"0= " cellpadding=3D"0"> <tr> <td width=3D"100%" colspan=3D"3" style=3D"border-collapse: collapse; mso-table-lspace: 0pt; mso-tabl= e-rspace: 0pt;"> <table width=3D"100%" cellspacing=3D"0" cellpadding=3D"0"> <tbody> <tr> <td class=3D"mobileColToRow extra-padding" width=3D"300= " valign=3D"top" style=3D"padding-left: 0; width: 300px;"> <div class=3D"mobileThumbnail" style=3D"width: 300p= x; overflow: hidden;"> <a href=3D"https://click1.e.hw-commercialdesign.com/bczscfvzplqybqjfyjkqfyv= qqvyqlbjsnpgpmncpjzfllg_jrrtjssnbmwbmfjqjttss.html" xt=3D"SPCLICK" name=3D"= nnn1" style=3D"color:#000 !important; text-decoration: none !important;"=20= data-cms-ai=3D"0"><img src=3D"https://cdnassets.hw.net/dims4/GG/0d32ffa/214= 7483647/thumbnail/300x200%3E/quality/90/?url=3Dhttps%3A%2F%2Fcdnassets.hw.n= et%2Fe5%2F11%2Fbbdd7b574fe599d8304d930b5dbc%2Fadobestock-29181375.jpeg" wid= th=3D"300" height=3D"200" border=3D"0" alt=3D"When Faced With Dwindling Dow= ntowns, Architects Can Support Growth from Within" data-size=3D"promo_300x2= 00"></a> </div> </td> <td style=3D"border-collapse: collapse; mso-table-lspac= e: 0pt; mso-table-rspace: 0pt;"> <table class=3D"img-spacer" width=3D"12" align=3D"c= enter" style=3D"width: 12px; height: 0;"> <tr> <td> </td> </tr> </table> </td> <td class=3D"mobileColToRow" width=3D"303" colspan=3D"1= " rowspan=3D"1" valign=3D"top" style=3D"clear: both; padding-left: 0; "> <table width=3D"100%"> <tbody> <tr> <td class=3D"eyebrow" style=3D"color:= #ed1f24; padding-bottom: 5px;"> <p style=3D"display: inline-block= !important; color: #ed1f24 !important; margin-top: 0; margin-bottom: 0 !im= portant; font-size: 0.7em; font-weight: bold; text-transform: uppercase;"> <span style=3D"display: inline-= block; color: #ed1f24;"> Universal Hubs </span> </p> </td> </tr> <tr> <td style=3D"color: #000000 !important;= "> <h2 style=3D"display: inline-block= !important; color: #000000; margin-top: 0; margin-bottom: 0 !important;=20= font-size: 1.4em; font-weight: bold; line-height: 1.1em;"> <a href=3D"https://click1.e.hw-commercialdesign.com/qhnjpsydmwfthfvstvqfsty= ffytfwhvjcmgmrcpmvdswwf_jrrtjssnbmwbmfjqjttss.html" xt=3D"SPCLICK" name=3D"= nnn2" style=3D"color: #000000 !important; text-decoration: none !important;= " data-cms-ai=3D"0"> <span= style=3D"color: #000000; text-decoration: none;"> When Faced With Dwindli= ng Downtowns, Architects Can Support Growth from Within </span> </a> </h2> </td> </tr> <tr> <td style=3D"color: #6c6c6c !important;= "> <p style=3D"margin-top: 0; margin-b= ottom: 0 !important; font-size: 0.9em; color: #6c6c6c !important; line-heig= ht: 1.5em;"> <span style=3D"color: #6c6c6c;"= > In Boswell, Ind., Nowhere=20= Collaborative shows us what a practice embedded in rural communities can=20= look like, writes Anjulie Rao. </span> <a href=3D"https://click1.e.hw-commercialdesign.com/rwchtnylcrvpwvknpkfvnpy= vvypvrwkhscgcbstcklnrrt_jrrtjssnbmwbmfjqjttss.html" xt=3D"SPCLICK" name=3D"= nnn3" style=3D"display: inline-block !important; color: #00aeed !important;= text-decoration: none !important;" class=3D"moreLink" data-cms-ai=3D"0">= <span class=3D"moreLink" style=3D"display: inl= ine-block; color: #00aeed; text-decoration: none; text-transform: uppercase= ;"> Read More </span> </a> </p> </td> </tr> </tbody> </table> </td> </tr> </tbody> </table> </td> </tr> <tr> <td height=3D"18"> </td> </tr> <tr> <td width=3D"100%" colspan=3D"3" style=3D"border-collapse: collapse; mso-table-lspace: 0pt; mso-tabl= e-rspace: 0pt;"> <table width=3D"100%" cellspacing=3D"0" cellpadding=3D"0"> <tbody> <tr> <td class=3D"mobileColToRow extra-padding" width=3D"300= " valign=3D"top" style=3D"padding-left: 0; width: 300px;"> <div class=3D"mobileThumbnail" style=3D"width: 300p= x; overflow: hidden;"> <a href=3D"https://click1.e.hw-commercialdesign.com/qhwjpsydmwfthfvstvqfsty= ffytfwhvjcmgmrcpmvdswwh_jrrtjssnbmwbmfjqjttss.html" xt=3D"SPCLICK" name=3D"= nnn4" style=3D"color:#000 !important; text-decoration: none !important;"=20= data-cms-ai=3D"0"><img src=3D"https://cdnassets.hw.net/dims4/GG/00d0b43/214= 7483647/thumbnail/300x200%3E/quality/90/?url=3Dhttps%3A%2F%2Fcdnassets.hw.n= et%2F16%2F89%2F6380629c484886ea5ef72bc1be64%2Fproxy.jpg" width=3D"300" heig= ht=3D"200" border=3D"0" alt=3D"HUD Awards $382 Million Through Housing Trus= t Fund" data-size=3D"promo_300x200"></a> </div> </td> <td style=3D"border-collapse: collapse; mso-table-lspac= e: 0pt; mso-table-rspace: 0pt;"> <table class=3D"img-spacer" width=3D"12" align=3D"c= enter" style=3D"width: 12px; height: 0;"> <tr> <td> </td> </tr> </table> </td> <td class=3D"mobileColToRow" width=3D"303" colspan=3D"1= " rowspan=3D"1" valign=3D"top" style=3D"clear: both; padding-left: 0; "> <table width=3D"100%"> <tbody> <tr> <td class=3D"eyebrow" style=3D"color:= #ed1f24; padding-bottom: 5px;"> <p style=3D"display: inline-block= !important; color: #ed1f24 !important; margin-top: 0; margin-bottom: 0 !im= portant; font-size: 0.7em; font-weight: bold; text-transform: uppercase;"> <span style=3D"display: inline-= block; color: #ed1f24;"> AFFORDABLE HOUSING FINANCE </span> </p> </td> </tr> <tr> <td style=3D"color: #000000 !important;= "> <h2 style=3D"display: inline-block= !important; color: #000000; margin-top: 0; margin-bottom: 0 !important;=20= font-size: 1.4em; font-weight: bold; line-height: 1.1em;"> <a href=3D"https://click1.e.hw-commercialdesign.com/asdvtdrlmkpnspydnyzpdnr= pprnpksyvcmhmgctmyldkkl_jrrtjssnbmwbmfjqjttss.html" xt=3D"SPCLICK" name=3D"= nnn5" style=3D"color: #000000 !important; text-decoration: none !important;= " data-cms-ai=3D"0"> <span= style=3D"color: #000000; text-decoration: none;"> HUD Awards $382 Million= Through Housing Trust Fund </span> </a> </h2> </td> </tr> <tr> <td style=3D"color: #6c6c6c !important;= "> <p style=3D"margin-top: 0; margin-b= ottom: 0 !important; font-size: 0.9em; color: #6c6c6c !important; line-heig= ht: 1.5em;"> <span style=3D"color: #6c6c6c;"= > California received the larg= est allocation of more than $62 million to increase and preserve affordable= housing for low-income households, including… </span> <a href=3D"https://click1.e.hw-commercialdesign.com/qngjpsydmwfthfvstvqfsty= ffytfwhvjcmgmrcpmvdswsn_jrrtjssnbmwbmfjqjttss.html" xt=3D"SPCLICK" name=3D"= nnn6" style=3D"display: inline-block !important; color: #00aeed !important;= text-decoration: none !important;" class=3D"moreLink" data-cms-ai=3D"0">= <span class=3D"moreLink" style=3D"display: inl= ine-block; color: #00aeed; text-decoration: none; text-transform: uppercase= ;"> Read More </span> </a> </p> </td> </tr> </tbody> </table> </td> </tr> </tbody> </table> </td> </tr> <tr> <td height=3D"18"> </td> </tr> <tr> <td class=3D"50-50" width=3D"100%" colspan=3D"3" style=3D"border-collapse: collapse; mso-table-lspace: 0pt; mso-tabl= e-rspace: 0pt; padding-bottom: 18px;"> <table width=3D"100%" border=3D"0" cellspacing=3D"0" cellpadding=3D= "0"> <tr> <td class=3D"mobileColToRow" align=3D"left" valign=3D"top" style=3D"border-= collapse: collapse; mso-table-lspace: 0pt; mso-table-rspace: 0pt; margin-to= p: 0; margin-right: 0; margin-bottom: 0; margin-left: 0; padding-top: 0;=20= padding-right: 0; padding-bottom: 0; padding-left: 0;"> <table border=3D"0" cellspacing=3D"0" cellpadding=3D"0" width=3D"300"> <tbody> <tr> <th style=3D"color: #000 !important; float: left; padding-left:= 5px; padding-bottom: 5px; font: 9pt arial;"> =20 </th> </tr> <tr> <td class=3D"mobileColToRow extra-padding" rowspan=3D"1" colspan=3D"1" valign=3D"top" style=3D"width: 300px; padding-left: 0px; "> <div class=3D"mobileThumbnail" style=3D"width: 300px; overflow: hidden;"> <a href=3D"https://click1.e.hw-commercialdesign.com/pflrcjwvhqlbdlyjbytljbw= llwblqdyrghmhkgchyvjqjh_jrrtjssnbmwbmfjqjttss.html" xt=3D"SPCLICK" name=3D"= nnn7" style=3D"color:#000 !important; text-decoration: none !important;"=20= data-cms-ai=3D"0"><img src=3D"https://cdnassets.hw.net/dims4/GG/821ec2a/214= 7483647/thumbnail/300x200%3E/quality/90/?url=3Dhttps%3A%2F%2Fcdnassets.hw.n= et%2F3d%2Fbc%2F7e10e491412e96f84c7e782e7fef%2Fwhat-goes-up-banner-hero.jpg"= width=3D"300" height=3D"200" border=3D"0" alt=3D"A Recent Report Shows Bui= lding Decarbonization Successes" data-size=3D"promo_300x200"></a> =20= </div> </td> </tr> <tr> <td style=3D"font-size: 0"> <table class=3D"img-spacer" height=3D"3" align=3D"center"= style=3D"height: 3px; font-size: 0;"><tr><td> </td></tr></table> </td> </tr> <tr> <td class=3D"eyebrow-padding eyebrow" style=3D"color: #ed1f24;= padding-bottom: 5px;"> <p style=3D"display: inline-block !important; color: #ed1f2= 4 !important; margin-top: 0; margin-bottom: 0 !important; font-size: 0.7em;= font-weight: bold; text-transform: uppercase;"> <span style=3D"display: inline-block; color: #ed1f24;">= Carbon Positive</span> </p> </td> </tr> <tr> <td style=3D"color: #000000 !important;"> <h2 style=3D"display: inline-block !important; color: #0000= 00; margin-top: 0; margin-bottom: 0 !important; font-size: 1.4em; font-weig= ht: bold; line-height: 1.1em;"> <a href=3D"https://click1.e.hw-commercialdesign.com/edzvzyjqrshfphtyftlhyfj= hhjfhsptvcrbrwczrtqysys_jrrtjssnbmwbmfjqjttss.html" xt=3D"SPCLICK" name=3D"= nnn8" style=3D"color: #000000 !important; text-decoration: none !important;= " data-cms-ai=3D"0"> <span style=3D"color: #000000;= text-decoration: none;">A Recent Report Shows Building Decarbonization Suc= cesses</span> </a> </h2> </td> </tr> <tr> <td style=3D"color: #6c6c6c !important;"> <p style=3D"margin-top: 0; margin-bottom: 0 !important; fon= t-size: 0.9em; color: #6c6c6c !important; line-height: 1.5em;"> <span style=3D"color: #6c6c6c;">Edward Mazria, founder= and CEO of the nonprofit Architecture 2030, uses six charts to tell a clim= ate change success story for the building sector.</span> <a href=3D"https://click1.e.hw-commercialdesign.com/sjlzsvwpbrktlkcvtcfkvtw= kkwtkrlczgbmbhgsbcpvrvv_jrrtjssnbmwbmfjqjttss.html" xt=3D"SPCLICK" name=3D"= nnn9" style=3D"display: inline-block !important; color: #00aeed !important;= text-decoration: none !important;" class=3D"moreLink" data-cms-ai=3D"0">= <span class=3D"moreLink" style=3D"display: inline-b= lock; color: #00aeed; text-decoration: none; text-transform: uppercase;">Re= ad More</span> </a> </p> </td> </tr> </tbody> </table> </td> <td> <table class=3D"spacer" width=3D"12" align=3D"c= enter" style=3D"width: 12px; height: 0;"> <tr> <td> </td> </tr> </table> </td> <td class=3D"mobileAdwrapper" align=3D"right" valign=3D"top" style=3D"borde= r-collapse: collapse; mso-table-lspace: 0pt; mso-table-rspace: 0pt; margin-= top: 0; margin-right: 0; margin-bottom: 0; margin-left: 0; padding-top: 0;= padding-right: 0; padding-bottom: 0; padding-left: 0;"> <table align=3D"center" style=3D"font: 7pt arial" bgcolor=3D"#ffffff"= border=3D"0" cellspacing=3D"0" cellpadding=3D"0" width=3D"300"> <tbody> <tr> <th style=3D"color:#000000 !important; float: left; padding-lef= t: 5px; padding-bottom: 5px;"> Advertisement </th> </tr> <tr> <td> <!-- POWERINBOX 300x250 --> <div class=3D"pi_17424 powerinbox"> <!-- domain: rs-stripe.architectmagazine.com --> <table width=3D"300" border=3D"0" cellpadding=3D"0" cellspacing=3D"0"> <tr> <td align=3D"center"> <a href=3D"https://click1.e.hw-commercialdesign.com/igctnvpcyhdwzdb= vwbkdvwpddpwdhzbtrymyqrnybcvhvb_jrrtjssnbmwbmfjqjttss.html?a=3Delvis%40ebaa= rchitects.org&b=3D63101" style=3D"border-style: none; outline: none; text-d= ecoration: none;" target=3D"_blank" ref=3D"nofollow"><img alt=3D"" height= =3D"250" src=3D"https://rs-stripe.architectmagazine.com/stripe/image?cs_ema= il=3Delvis@ebaarchitects.org&cs_sendid=3D63101&cs_esp=3Dpostup&cs_offset=3D= 0&cs_stripeid=3D17424&dfp_nl_send_date=3D05/09/2023" style=3D"display: bloc= k; border: 0; height: auto; line-height: 100%; outline: none; text-decorati= on: none;" width=3D"300"></a> </td> </tr> </table> </div> <!-- POWERINBOX 300x250 --> </td> </tr> </tbody> </table> </td> </tr> </table> </td> </tr> <tr> <td height=3D"18"> </td> </tr> <tr> <td width=3D"100%" colspan=3D"3" style=3D"border-collapse: collapse; mso-table-lspace: 0pt; mso-tabl= e-rspace: 0pt;"> <table width=3D"100%" cellspacing=3D"0" cellpadding=3D"0"> <tbody> <tr> <td class=3D"mobileColToRow extra-padding" width=3D"300= " valign=3D"top" style=3D"padding-left: 0; width: 300px;"> <div class=3D"mobileThumbnail" style=3D"width: 300p= x; overflow: hidden;"> <a href=3D"https://click1.e.hw-commercialdesign.com/xdgnjhkcdvbtsbphtplbhtk= bbktbvspnydrdqyjdpchvhr_jrrtjssnbmwbmfjqjttss.html" xt=3D"SPCLICK" name=3D"= nnn10" style=3D"color:#000 !important; text-decoration: none !important;"= data-cms-ai=3D"0"><img src=3D"https://cdnassets.hw.net/dims4/GG/c653e15/21= 47483647/thumbnail/300x200%3E/quality/90/?url=3Dhttps%3A%2F%2Fcdnassets.hw.= net%2Fa4%2F00%2Fe50bad194268bb8389877482d07f%2Fdallas-museum-of-art-interio= r-concourse-image-courtesy-of-the-dallas-museum-of-art.jpg" width=3D"300"= height=3D"200" border=3D"0" alt=3D"The Dallas Museum of Art Names Six Fina= lists in Its International Design Competition" data-size=3D"promo_300x200">= </a> </div> </td> <td style=3D"border-collapse: collapse; mso-table-lspac= e: 0pt; mso-table-rspace: 0pt;"> <table class=3D"img-spacer" width=3D"12" align=3D"c= enter" style=3D"width: 12px; height: 0;"> <tr> <td> </td> </tr> </table> </td> <td class=3D"mobileColToRow" width=3D"303" colspan=3D"1= " rowspan=3D"1" valign=3D"top" style=3D"clear: both; padding-left: 0; "> <table width=3D"100%"> <tbody> <tr> <td class=3D"eyebrow" style=3D"color:= #ed1f24; padding-bottom: 5px;"> <p style=3D"display: inline-block= !important; color: #ed1f24 !important; margin-top: 0; margin-bottom: 0 !im= portant; font-size: 0.7em; font-weight: bold; text-transform: uppercase;"> <span style=3D"display: inline-= block; color: #ed1f24;"> Competitions </span> </p> </td> </tr> <tr> <td style=3D"color: #000000 !important;= "> <h2 style=3D"display: inline-block= !important; color: #000000; margin-top: 0; margin-bottom: 0 !important;=20= font-size: 1.4em; font-weight: bold; line-height: 1.1em;"> <a href=3D"https://click1.e.hw-commercialdesign.com/rcchtnylcrvpwvknpkfvnpy= vvypvrwkhscgcbstcklnrnv_jrrtjssnbmwbmfjqjttss.html" xt=3D"SPCLICK" name=3D"= nnn11" style=3D"color: #000000 !important; text-decoration: none !important= ;" data-cms-ai=3D"0"> <span= style=3D"color: #000000; text-decoration: none;"> The Dallas Museum of Art= Names Six Finalists in Its International Design Competition </span> </a> </h2> </td> </tr> <tr> <td style=3D"color: #6c6c6c !important;= "> <p style=3D"margin-top: 0; margin-b= ottom: 0 !important; font-size: 0.9em; color: #6c6c6c !important; line-heig= ht: 1.5em;"> <span style=3D"color: #6c6c6c;"= > After receiving 154 submissions,= the Reimagining the Dallas Museum of Art International Design Competition= has announced a shortlist of firms in the… </span> <a href=3D"https://click1.e.hw-commercialdesign.com/vfvqjpdyfvgnmgkpnkbgpnd= ggdngvmkqcfhfzcjfkypvpj_jrrtjssnbmwbmfjqjttss.html" xt=3D"SPCLICK" name=3D"= nnn12" style=3D"display: inline-block !important; color: #00aeed !important= ; text-decoration: none !important;" class=3D"moreLink" data-cms-ai=3D"0">= <span class=3D"moreLink" style=3D"display: inl= ine-block; color: #00aeed; text-decoration: none; text-transform: uppercase= ;"> Read More </span> </a> </p> </td> </tr> </tbody> </table> </td> </tr> </tbody> </table> </td> </tr> <tr> <td height=3D"18"> </td> </tr> <tr> <td width=3D"100%" colspan=3D"3" style=3D"border-collapse: collapse; mso-table-lspace: 0pt; mso-tabl= e-rspace: 0pt;"> <table width=3D"100%" cellspacing=3D"0" cellpadding=3D"0"> <tbody> <tr> <td class=3D"mobileColToRow extra-padding" width=3D"300= " valign=3D"top" style=3D"padding-left: 0; width: 300px;"> <div class=3D"mobileThumbnail" style=3D"width: 300p= x; overflow: hidden;"> <a href=3D"https://click1.e.hw-commercialdesign.com/lmgfwgshmknrqndgrdpngrs= nnsrnkqdflmjmclwmdhgkgq_jrrtjssnbmwbmfjqjttss.html" xt=3D"SPCLICK" name=3D"= nnn13" style=3D"color:#000 !important; text-decoration: none !important;"= data-cms-ai=3D"0"><img src=3D"https://cdnassets.hw.net/dims4/GG/4ee2081/21= 47483647/thumbnail/300x200%3E/quality/90/?url=3Dhttps%3A%2F%2Fcdnassets.hw.= net%2F86%2F5b%2F6364fc40481a823739d2a1e8af0b%2Fmorrowhighschool-perkins-wil= l-cjonathanhillyer-10.jpg" width=3D"300" height=3D"200" border=3D"0" alt=3D= "Morrow High School, by Perkins&Will" data-size=3D"promo_300x200"></a> =20= </div> </td> <td style=3D"border-collapse: collapse; mso-table-lspac= e: 0pt; mso-table-rspace: 0pt;"> <table class=3D"img-spacer" width=3D"12" align=3D"c= enter" style=3D"width: 12px; height: 0;"> <tr> <td> </td> </tr> </table> </td> <td class=3D"mobileColToRow" width=3D"303" colspan=3D"1= " rowspan=3D"1" valign=3D"top" style=3D"clear: both; padding-left: 0; "> <table width=3D"100%"> <tbody> <tr> <td class=3D"eyebrow" style=3D"color:= #ed1f24; padding-bottom: 5px;"> <p style=3D"display: inline-block= !important; color: #ed1f24 !important; margin-top: 0; margin-bottom: 0 !im= portant; font-size: 0.7em; font-weight: bold; text-transform: uppercase;"> <span style=3D"display: inline-= block; color: #ed1f24;"> Education Project </span> </p> </td> </tr> <tr> <td style=3D"color: #000000 !important;= "> <h2 style=3D"display: inline-block= !important; color: #000000; margin-top: 0; margin-bottom: 0 !important;=20= font-size: 1.4em; font-weight: bold; line-height: 1.1em;"> <a href=3D"https://click1.e.hw-commercialdesign.com/hvslhbjfvqwzmwsbzsrwbzj= wwjzwqmsldvcvpdhvsfbqbf_jrrtjssnbmwbmfjqjttss.html" xt=3D"SPCLICK" name=3D"= nnn14" style=3D"color: #000000 !important; text-decoration: none !important= ;" data-cms-ai=3D"0"> <span= style=3D"color: #000000; text-decoration: none;"> Morrow High School, by= Perkins&Will </span> </a> </h2> </td> </tr> <tr> <td style=3D"color: #6c6c6c !important;= "> <p style=3D"margin-top: 0; margin-b= ottom: 0 !important; font-size: 0.9em; color: #6c6c6c !important; line-heig= ht: 1.5em;"> <span style=3D"color: #6c6c6c;"= > The S-shaped facility offers= an alternative to a traditional, double-loaded corridor school. </span> <a href=3D"https://click1.e.hw-commercialdesign.com/lgnfwgshmknrqndgrdpngrs= nnsrnkqdflmjmclwmdhgkdz_jrrtjssnbmwbmfjqjttss.html" xt=3D"SPCLICK" name=3D"= nnn15" style=3D"display: inline-block !important; color: #00aeed !important= ; text-decoration: none !important;" class=3D"moreLink" data-cms-ai=3D"0">= <span class=3D"moreLink" style=3D"display: inl= ine-block; color: #00aeed; text-decoration: none; text-transform: uppercase= ;"> Read More </span> </a> </p> </td> </tr> </tbody> </table> </td> </tr> </tbody> </table> </td> </tr> <tr> <td height=3D"18"> </td> </tr> <tr> <td class=3D"50-50" width=3D"100%" colspan=3D"3" style=3D"border-collapse: collapse; mso-table-lspace: 0pt; mso-tabl= e-rspace: 0pt; padding-bottom: 18px;"> <table width=3D"100%" border=3D"0" cellspacing=3D"0" cellpadding=3D= "0"> <tr> <td class=3D"mobileColToRow" align=3D"left" valign=3D"top" style=3D"border-= collapse: collapse; mso-table-lspace: 0pt; mso-table-rspace: 0pt; margin-to= p: 0; margin-right: 0; margin-bottom: 0; margin-left: 0; padding-top: 0;=20= padding-right: 0; padding-bottom: 0; padding-left: 0;"> <table border=3D"0" cellspacing=3D"0" cellpadding=3D"0" width=3D"300"> <tbody> <tr> <th style=3D"color: #000 !important; float: left; padding-left:= 5px; padding-bottom: 5px; font: 9pt arial;"> =20 </th> </tr> <tr> <td class=3D"mobileColToRow extra-padding" rowspan=3D"1" colspan=3D"1" valign=3D"top" style=3D"width: 300px; padding-left: 0px; "> <div class=3D"mobileThumbnail" style=3D"width: 300px; overflow: hidden;"> <a href=3D"https://click1.e.hw-commercialdesign.com/jjqzqjcnbrmwfmtjwthmjwc= mmcwmrftzpbvbkpqbtnjrtb_jrrtjssnbmwbmfjqjttss.html" xt=3D"SPCLICK" name=3D"= nnn16" style=3D"color:#000 !important; text-decoration: none !important;"= data-cms-ai=3D"0"><img src=3D"https://cdnassets.hw.net/dims4/GG/1827254/21= 47483647/thumbnail/300x200%3E/quality/90/?url=3Dhttps%3A%2F%2Fcdnassets.hw.= net%2Fe1%2Fad%2F2dd89c0640fb9e52a44622bf4eed%2Feli-and-susan-april-2023-190= 0x1270.jpg" width=3D"300" height=3D"200" border=3D"0" alt=3D"HOK Appoints= Co-CEOs" data-size=3D"promo_300x200"></a> </div> </td> </tr> <tr> <td style=3D"font-size: 0"> <table class=3D"img-spacer" height=3D"3" align=3D"center"= style=3D"height: 3px; font-size: 0;"><tr><td> </td></tr></table> </td> </tr> <tr> <td class=3D"eyebrow-padding eyebrow" style=3D"color: #ed1f24;= padding-bottom: 5px;"> <p style=3D"display: inline-block !important; color: #ed1f2= 4 !important; margin-top: 0; margin-bottom: 0 !important; font-size: 0.7em;= font-weight: bold; text-transform: uppercase;"> <span style=3D"display: inline-block; color: #ed1f24;">= Leadership</span> </p> </td> </tr> <tr> <td style=3D"color: #000000 !important;"> <h2 style=3D"display: inline-block !important; color: #0000= 00; margin-top: 0; margin-bottom: 0 !important; font-size: 1.4em; font-weig= ht: bold; line-height: 1.1em;"> <a href=3D"https://click1.e.hw-commercialdesign.com/rnwhtnylcrvpwvknpkfvnpy= vvypvrwkhscgcbstcklnrkr_jrrtjssnbmwbmfjqjttss.html" xt=3D"SPCLICK" name=3D"= nnn17" style=3D"color: #000000 !important; text-decoration: none !important= ;" data-cms-ai=3D"0"> <span style=3D"color: #000000;= text-decoration: none;">HOK Appoints Co-CEOs</span> </a> </h2> </td> </tr> <tr> <td style=3D"color: #6c6c6c !important;"> <p style=3D"margin-top: 0; margin-bottom: 0 !important; fon= t-size: 0.9em; color: #6c6c6c !important; line-height: 1.5em;"> <span style=3D"color: #6c6c6c;">The firm has named Susa= n Klumpp Williams and Eli Hoisington as its new co-chief executive officers= =2E</span> <a href=3D"https://click1.e.hw-commercialdesign.com/vpyqjpdyfvgnmgkpnkbgpnd= ggdngvmkqcfhfzcjfkypvkp_jrrtjssnbmwbmfjqjttss.html" xt=3D"SPCLICK" name=3D"= nnn18" style=3D"display: inline-block !important; color: #00aeed !important= ; text-decoration: none !important;" class=3D"moreLink" data-cms-ai=3D"0">= <span class=3D"moreLink" style=3D"display: inline-b= lock; color: #00aeed; text-decoration: none; text-transform: uppercase;">Re= ad More</span> </a> </p> </td> </tr> </tbody> </table> </td> <td> <table class=3D"spacer" width=3D"12" align=3D"c= enter" style=3D"width: 12px; height: 0;"> <tr> <td> </td> </tr> </table> </td> <td class=3D"mobileAdwrapper" align=3D"right" valign=3D"top" style=3D"borde= r-collapse: collapse; mso-table-lspace: 0pt; mso-table-rspace: 0pt; margin-= top: 0; margin-right: 0; margin-bottom: 0; margin-left: 0; padding-top: 0;= padding-right: 0; padding-bottom: 0; padding-left: 0;"> <table align=3D"center" style=3D"font: 7pt arial" bgcolor=3D"#ffffff"= border=3D"0" cellspacing=3D"0" cellpadding=3D"0" width=3D"300"> <tbody> <tr> <th style=3D"color:#000000 !important; float: left; padding-lef= t: 5px; padding-bottom: 5px;"> Advertisement </th> </tr> <tr> <td> <!-- POWERINBOX 300x250 --> <div class=3D"pi_17425 powerinbox"> <!-- domain: rs-stripe.architectmagazine.com --> <table width=3D"300" border=3D"0" cellpadding=3D"0" cellspacing=3D"0"> <tr> <td align=3D"center"> <a href=3D"https://click1.e.hw-commercialdesign.com/jtszqjcnbrmwfmt= jwthmjwcmmcwmrftzpbvbkpqbtnjrtt_jrrtjssnbmwbmfjqjttss.html?a=3Delvis%40ebaa= rchitects.org&b=3D63101" style=3D"border-style: none; outline: none; text-d= ecoration: none;" target=3D"_blank" ref=3D"nofollow" data-cms-ai=3D"0"><img= alt=3D"" height=3D"250" src=3D"https://rs-stripe.architectmagazine.com/str= ipe/image?cs_email=3Delvis@ebaarchitects.org&cs_sendid=3D63101&cs_esp=3Dpos= tup&cs_offset=3D0&cs_stripeid=3D17425&dfp_nl_send_date=3D05/09/2023" style= =3D"display: block; border: 0; height: auto; line-height: 100%; outline:=20= none; text-decoration: none;" width=3D"300"></a> </td> </tr> </table> </div> <!-- POWERINBOX 300x250 --> </td> </tr> </tbody> </table> </td> </tr> </table> </td> </tr> <tr> <td height=3D"18"> </td> </tr> <tr> <td width=3D"100%" colspan=3D"3" style=3D"border-collapse: collapse; mso-table-lspace: 0pt; mso-tabl= e-rspace: 0pt;"> <table width=3D"100%" cellspacing=3D"0" cellpadding=3D"0"> <tbody> <tr> <td class=3D"mobileColToRow extra-padding" width=3D"300= " valign=3D"top" style=3D"padding-left: 0; width: 300px;"> <div class=3D"mobileThumbnail" style=3D"width: 300p= x; overflow: hidden;"> <a href=3D"https://click1.e.hw-commercialdesign.com/bjpscfvzplqybqjfyjkqfyv= qqvyqlbjsnpgpmncpjzfljg_jrrtjssnbmwbmfjqjttss.html" xt=3D"SPCLICK" name=3D"= nnn19" style=3D"color:#000 !important; text-decoration: none !important;"= data-cms-ai=3D"0"><img src=3D"https://cdnassets.hw.net/dims4/GG/af32129/21= 47483647/thumbnail/300x200%3E/quality/90/?url=3Dhttps%3A%2F%2Fcdnassets.hw.= net%2F82%2Fc7%2Fccef7fe5463a8782e391ec84246e%2Fhero-yasmeen-lari-portrait-h= ires-anam-baig-copy.jpg" width=3D"300" height=3D"200" border=3D"0" alt=3D"Y= asmeen Lari, Pakistan's First Female Architect, Wins 2023 RIBA Gold Medal"= data-size=3D"promo_300x200"></a> </div> </td> <td style=3D"border-collapse: collapse; mso-table-lspac= e: 0pt; mso-table-rspace: 0pt;"> <table class=3D"img-spacer" width=3D"12" align=3D"c= enter" style=3D"width: 12px; height: 0;"> <tr> <td> </td> </tr> </table> </td> <td class=3D"mobileColToRow" width=3D"303" colspan=3D"1= " rowspan=3D"1" valign=3D"top" style=3D"clear: both; padding-left: 0; "> <table width=3D"100%"> <tbody> <tr> <td class=3D"eyebrow" style=3D"color:= #ed1f24; padding-bottom: 5px;"> <p style=3D"display: inline-block= !important; color: #ed1f24 !important; margin-top: 0; margin-bottom: 0 !im= portant; font-size: 0.7em; font-weight: bold; text-transform: uppercase;"> <span style=3D"display: inline-= block; color: #ed1f24;"> Awards </span> </p> </td> </tr> <tr> <td style=3D"color: #000000 !important;= "> <h2 style=3D"display: inline-block= !important; color: #000000; margin-top: 0; margin-bottom: 0 !important;=20= font-size: 1.4em; font-weight: bold; line-height: 1.1em;"> <a href=3D"https://click1.e.hw-commercialdesign.com/scrzsvwpbrktlkcvtcfkvtw= kkwtkrlczgbmbhgsbcpvrck_jrrtjssnbmwbmfjqjttss.html" xt=3D"SPCLICK" name=3D"= nnn20" style=3D"color: #000000 !important; text-decoration: none !important= ;" data-cms-ai=3D"0"> <span= style=3D"color: #000000; text-decoration: none;"> Yasmeen Lari, Pakistan'= s First Female Architect, Wins 2023 RIBA Gold Medal </span> </a> </h2> </td> </tr> <tr> <td style=3D"color: #6c6c6c !important;= "> <p style=3D"margin-top: 0; margin-b= ottom: 0 !important; font-size: 0.9em; color: #6c6c6c !important; line-heig= ht: 1.5em;"> <span style=3D"color: #6c6c6c;"= > Lari is renowned for her huma= nitarian work and emphasis on sustainable design. </span> <a href=3D"https://click1.e.hw-commercialdesign.com/fbhcghtydsnwrnbhwbznhwt= nntwnsrbcpdjdlpgdbyhsbg_jrrtjssnbmwbmfjqjttss.html" xt=3D"SPCLICK" name=3D"= nnn21" style=3D"display: inline-block !important; color: #00aeed !important= ; text-decoration: none !important;" class=3D"moreLink" data-cms-ai=3D"0">= <span class=3D"moreLink" style=3D"display: inl= ine-block; color: #00aeed; text-decoration: none; text-transform: uppercase= ;"> Read More </span> </a> </p> </td> </tr> </tbody> </table> </td> </tr> </tbody> </table> </td> </tr> <tr> <td height=3D"18"> </td> </tr> <tr> <td width=3D"100%" colspan=3D"3" style=3D"border-collapse: collapse; mso-table-lspace: 0pt; mso-tabl= e-rspace: 0pt;"> <table width=3D"100%" cellspacing=3D"0" cellpadding=3D"0"> <tbody> <tr> <td class=3D"mobileColToRow extra-padding" width=3D"300= " valign=3D"top" style=3D"padding-left: 0; width: 300px;"> <div class=3D"mobileThumbnail" style=3D"width: 300p= x; overflow: hidden;"> <a href=3D"https://click1.e.hw-commercialdesign.com/ettvzyjqrshfphtyftlhyfj= hhjfhsptvcrbrwczrtqystp_jrrtjssnbmwbmfjqjttss.html" xt=3D"SPCLICK" name=3D"= nnn22" style=3D"color:#000 !important; text-decoration: none !important;"= data-cms-ai=3D"0"><img src=3D"https://cdnassets.hw.net/dims4/GG/70452a8/21= 47483647/thumbnail/300x200%3E/quality/90/?url=3Dhttps%3A%2F%2Fcdnassets.hw.= net%2F88%2F3c%2F60cb1f9b4caca89d64cc40b77e1b%2Fsalone-berg-hero.jpg" width= =3D"300" height=3D"200" border=3D"0" alt=3D"In Milan, the Atmosphere of a= Changing Design World" data-size=3D"promo_300x200"></a> =20= </div> </td> <td style=3D"border-collapse: collapse; mso-table-lspac= e: 0pt; mso-table-rspace: 0pt;"> <table class=3D"img-spacer" width=3D"12" align=3D"c= enter" style=3D"width: 12px; height: 0;"> <tr> <td> </td> </tr> </table> </td> <td class=3D"mobileColToRow" width=3D"303" colspan=3D"1= " rowspan=3D"1" valign=3D"top" style=3D"clear: both; padding-left: 0; "> <table width=3D"100%"> <tbody> <tr> <td class=3D"eyebrow" style=3D"color:= #ed1f24; padding-bottom: 5px;"> <p style=3D"display: inline-block= !important; color: #ed1f24 !important; margin-top: 0; margin-bottom: 0 !im= portant; font-size: 0.7em; font-weight: bold; text-transform: uppercase;"> <span style=3D"display: inline-= block; color: #ed1f24;"> Postcard from Milan </span> </p> </td> </tr> <tr> <td style=3D"color: #000000 !important;= "> <h2 style=3D"display: inline-block= !important; color: #000000; margin-top: 0; margin-bottom: 0 !important;=20= font-size: 1.4em; font-weight: bold; line-height: 1.1em;"> <a href=3D"https://click1.e.hw-commercialdesign.com/hsclhbjfvqwzmwsbzsrwbzj= wwjzwqmsldvcvpdhvsfbqsf_jrrtjssnbmwbmfjqjttss.html" xt=3D"SPCLICK" name=3D"= nnn23" style=3D"color: #000000 !important; text-decoration: none !important= ;" data-cms-ai=3D"0"> <span= style=3D"color: #000000; text-decoration: none;"> In Milan, the Atmosphere= of a Changing Design World </span> </a> </h2> </td> </tr> <tr> <td style=3D"color: #6c6c6c !important;= "> <p style=3D"margin-top: 0; margin-b= ottom: 0 !important; font-size: 0.9em; color: #6c6c6c !important; line-heig= ht: 1.5em;"> <span style=3D"color: #6c6c6c;"= > At the 61st Salone del Mobile= in Milan, Ian Volner finds "remarkably good" work amid some disjointed vib= es. </span> <a href=3D"https://click1.e.hw-commercialdesign.com/ygbpbqyvslgncgfqnfrgqny= ggynglcfpwskstwbsfvqlkm_jrrtjssnbmwbmfjqjttss.html" xt=3D"SPCLICK" name=3D"= nnn24" style=3D"display: inline-block !important; color: #00aeed !important= ; text-decoration: none !important;" class=3D"moreLink" data-cms-ai=3D"0">= <span class=3D"moreLink" style=3D"display: inl= ine-block; color: #00aeed; text-decoration: none; text-transform: uppercase= ;"> Read More </span> </a> </p> </td> </tr> </tbody> </table> </td> </tr> </tbody> </table> </td> </tr> <tr> <td height=3D"18"> </td> </tr> <tr> <td width=3D"100%" colspan=3D"3" style=3D"border-collapse: collapse; mso-table-lspace: 0pt; mso-tabl= e-rspace: 0pt;"> <table width=3D"100%" cellspacing=3D"0" cellpadding=3D"0"> <tbody> <tr> <td class=3D"mobileColToRow extra-padding" width=3D"300= " valign=3D"top" style=3D"padding-left: 0; width: 300px;"> <div class=3D"mobileThumbnail" style=3D"width: 300p= x; overflow: hidden;"> <a href=3D"https://click1.e.hw-commercialdesign.com/sklzsvwpbrktlkcvtcfkvtw= kkwtkrlczgbmbhgsbcpvrmb_jrrtjssnbmwbmfjqjttss.html" xt=3D"SPCLICK" name=3D"= nnn25" style=3D"color:#000 !important; text-decoration: none !important;"= data-cms-ai=3D"0"><img src=3D"https://cdnassets.hw.net/dims4/GG/b942879/21= 47483647/thumbnail/300x200%3E/quality/90/?url=3Dhttps%3A%2F%2Fcdnassets.hw.= net%2Fc5%2F1e%2Fe40a06684fa5918affe86fdaf2d3%2Fautodesk-report-hero.jpg"=20= width=3D"300" height=3D"200" border=3D"0" alt=3D"Autodesk Releases Inaugura= l "State of Design & Make" Report" data-size=3D"promo_300x200"></a> =20= </div> </td> <td style=3D"border-collapse: collapse; mso-table-lspac= e: 0pt; mso-table-rspace: 0pt;"> <table class=3D"img-spacer" width=3D"12" align=3D"c= enter" style=3D"width: 12px; height: 0;"> <tr> <td> </td> </tr> </table> </td> <td class=3D"mobileColToRow" width=3D"303" colspan=3D"1= " rowspan=3D"1" valign=3D"top" style=3D"clear: both; padding-left: 0; "> <table width=3D"100%"> <tbody> <tr> <td class=3D"eyebrow" style=3D"color:= #ed1f24; padding-bottom: 5px;"> <p style=3D"display: inline-block= !important; color: #ed1f24 !important; margin-top: 0; margin-bottom: 0 !im= portant; font-size: 0.7em; font-weight: bold; text-transform: uppercase;"> <span style=3D"display: inline-= block; color: #ed1f24;"> Technology </span> </p> </td> </tr> <tr> <td style=3D"color: #000000 !important;= "> <h2 style=3D"display: inline-block= !important; color: #000000; margin-top: 0; margin-bottom: 0 !important;=20= font-size: 1.4em; font-weight: bold; line-height: 1.1em;"> <a href=3D"https://click1.e.hw-commercialdesign.com/ehqvzyjqrshfphtyftlhyfj= hhjfhsptvcrbrwczrtqysbs_jrrtjssnbmwbmfjqjttss.html" xt=3D"SPCLICK" name=3D"= nnn26" style=3D"color: #000000 !important; text-decoration: none !important= ;" data-cms-ai=3D"0"> <span= style=3D"color: #000000; text-decoration: none;"> Autodesk Releases Inaug= ural "State of Design & Make" Report </span> </a> </h2> </td> </tr> <tr> <td style=3D"color: #6c6c6c !important;= "> <p style=3D"margin-top: 0; margin-b= ottom: 0 !important; font-size: 0.9em; color: #6c6c6c !important; line-heig= ht: 1.5em;"> <span style=3D"color: #6c6c6c;"= > The software behemoth's new= study offers a global perspective on sustainability, employment, and the= state of digital tools in the AEC industry. </span> <a href=3D"https://click1.e.hw-commercialdesign.com/ssjzsvwpbrktlkcvtcfkvtw= kkwtkrlczgbmbhgsbcpvrmv_jrrtjssnbmwbmfjqjttss.html" xt=3D"SPCLICK" name=3D"= nnn27" style=3D"display: inline-block !important; color: #00aeed !important= ; text-decoration: none !important;" class=3D"moreLink" data-cms-ai=3D"0">= <span class=3D"moreLink" style=3D"display: inl= ine-block; color: #00aeed; text-decoration: none; text-transform: uppercase= ;"> Read More </span> </a> </p> </td> </tr> </tbody> </table> </td> </tr> </tbody> </table> </td> </tr> <tr> <td height=3D"18"> </td> </tr> <tr> <td width=3D"100%" colspan=3D"3" style=3D"border-collapse: collapse; mso-table-lspace: 0pt; mso-tabl= e-rspace: 0pt;"> <table width=3D"100%" cellspacing=3D"0" cellpadding=3D"0"> <tbody> <tr> <td class=3D"mobileColToRow extra-padding" width=3D"300= " valign=3D"top" style=3D"padding-left: 0; width: 300px;"> <div class=3D"mobileThumbnail" style=3D"width: 300p= x; overflow: hidden;"> <a href=3D"https://click1.e.hw-commercialdesign.com/bcpscfvzplqybqjfyjkqfyv= qqvyqlbjsnpgpmncpjzflgj_jrrtjssnbmwbmfjqjttss.html" xt=3D"SPCLICK" name=3D"= nnn28" style=3D"color:#000 !important; text-decoration: none !important;"= data-cms-ai=3D"0"><img src=3D"https://cdnassets.hw.net/dims4/GG/f57b6e4/21= 47483647/thumbnail/300x200%3E/quality/90/?url=3Dhttps%3A%2F%2Fcdnassets.hw.= net%2F50%2F23%2F0138cd40498c84983144c0513734%2Fdeea572e-c691-4f48-a88f-7d3f= 0d7ab849.jpeg" width=3D"300" height=3D"200" border=3D"0" alt=3D"Tennessee= Performing Arts Center Selects Design Team for Its Relocation" data-size= =3D"promo_300x200"></a> </div> </td> <td style=3D"border-collapse: collapse; mso-table-lspac= e: 0pt; mso-table-rspace: 0pt;"> <table class=3D"img-spacer" width=3D"12" align=3D"c= enter" style=3D"width: 12px; height: 0;"> <tr> <td> </td> </tr> </table> </td> <td class=3D"mobileColToRow" width=3D"303" colspan=3D"1= " rowspan=3D"1" valign=3D"top" style=3D"clear: both; padding-left: 0; "> <table width=3D"100%"> <tbody> <tr> <td class=3D"eyebrow" style=3D"color:= #ed1f24; padding-bottom: 5px;"> <p style=3D"display: inline-block= !important; color: #ed1f24 !important; margin-top: 0; margin-bottom: 0 !im= portant; font-size: 0.7em; font-weight: bold; text-transform: uppercase;"> <span style=3D"display: inline-= block; color: #ed1f24;"> Press Release </span> </p> </td> </tr> <tr> <td style=3D"color: #000000 !important;= "> <h2 style=3D"display: inline-block= !important; color: #000000; margin-top: 0; margin-bottom: 0 !important;=20= font-size: 1.4em; font-weight: bold; line-height: 1.1em;"> <a href=3D"https://click1.e.hw-commercialdesign.com/glyjlgsmcytdntkgdkqtgds= ttsdtynkjfcrcpflckmgyrr_jrrtjssnbmwbmfjqjttss.html" xt=3D"SPCLICK" name=3D"= nnn29" style=3D"color: #000000 !important; text-decoration: none !important= ;" data-cms-ai=3D"0"> <span= style=3D"color: #000000; text-decoration: none;"> Tennessee Performing Art= s Center Selects Design Team for Its Relocation </span> </a> </h2> </td> </tr> <tr> <td style=3D"color: #6c6c6c !important;= "> <p style=3D"margin-top: 0; margin-b= ottom: 0 !important; font-size: 0.9em; color: #6c6c6c !important; line-heig= ht: 1.5em;"> <span style=3D"color: #6c6c6c;"= > The team includes Bjarke Ing= els Group, William Rawn Associates Architects, and EOA Architects. </span> <a href=3D"https://click1.e.hw-commercialdesign.com/tmhdmhsplzckjcbhkbfchks= ccskczjbdtlvlrtmlbphzvc_jrrtjssnbmwbmfjqjttss.html" xt=3D"SPCLICK" name=3D"= nnn30" style=3D"display: inline-block !important; color: #00aeed !important= ; text-decoration: none !important;" class=3D"moreLink" data-cms-ai=3D"0">= <span class=3D"moreLink" style=3D"display: inl= ine-block; color: #00aeed; text-decoration: none; text-transform: uppercase= ;"> Read More </span> </a> </p> </td> </tr> </tbody> </table> </td> </tr> </tbody> </table> </td> </tr> <tr> <td height=3D"18"> </td> </tr> <tr> <td width=3D"100%" colspan=3D"3" style=3D"border-collapse: collapse; mso-table-lspace: 0pt; mso-tabl= e-rspace: 0pt;"> <table width=3D"100%" cellspacing=3D"0" cellpadding=3D"0"> <tbody> <tr> <td class=3D"mobileColToRow extra-padding" width=3D"300= " valign=3D"top" style=3D"padding-left: 0; width: 300px;"> <div class=3D"mobileThumbnail" style=3D"width: 300p= x; overflow: hidden;"> <a href=3D"https://click1.e.hw-commercialdesign.com/upgzpwvchqfsmfgwsgbfwsv= ffvsfqmgzjhnhkjphgcwqnp_jrrtjssnbmwbmfjqjttss.html" xt=3D"SPCLICK" name=3D"= nnn31" style=3D"color:#000 !important; text-decoration: none !important;"= data-cms-ai=3D"0"><img src=3D"https://cdnassets.hw.net/dims4/GG/3cb4525/21= 47483647/thumbnail/300x200%3E/quality/90/?url=3Dhttps%3A%2F%2Fcdnassets.hw.= net%2F7d%2Fed%2Fbe41cf0044788130ac451fb54663%2Fbioplastic-hero.jpg" width= =3D"300" height=3D"200" border=3D"0" alt=3D"Is There New Hope for Plastic?"= data-size=3D"promo_300x200"></a> </div> </td> <td style=3D"border-collapse: collapse; mso-table-lspac= e: 0pt; mso-table-rspace: 0pt;"> <table class=3D"img-spacer" width=3D"12" align=3D"c= enter" style=3D"width: 12px; height: 0;"> <tr> <td> </td> </tr> </table> </td> <td class=3D"mobileColToRow" width=3D"303" colspan=3D"1= " rowspan=3D"1" valign=3D"top" style=3D"clear: both; padding-left: 0; "> <table width=3D"100%"> <tbody> <tr> <td class=3D"eyebrow" style=3D"color:= #ed1f24; padding-bottom: 5px;"> <p style=3D"display: inline-block= !important; color: #ed1f24 !important; margin-top: 0; margin-bottom: 0 !im= portant; font-size: 0.7em; font-weight: bold; text-transform: uppercase;"> <span style=3D"display: inline-= block; color: #ed1f24;"> Mind & Matter </span> </p> </td> </tr> <tr> <td style=3D"color: #000000 !important;= "> <h2 style=3D"display: inline-block= !important; color: #000000; margin-top: 0; margin-bottom: 0 !important;=20= font-size: 1.4em; font-weight: bold; line-height: 1.1em;"> <a href=3D"https://click1.e.hw-commercialdesign.com/tmvdmhsplzckjcbhkbfchks= ccskczjbdtlvlrtmlbphzvj_jrrtjssnbmwbmfjqjttss.html" xt=3D"SPCLICK" name=3D"= nnn32" style=3D"color: #000000 !important; text-decoration: none !important= ;" data-cms-ai=3D"0"> <span= style=3D"color: #000000; text-decoration: none;"> Is There New Hope for= Plastic? </span> </a> </h2> </td> </tr> <tr> <td style=3D"color: #6c6c6c !important;= "> <p style=3D"margin-top: 0; margin-b= ottom: 0 !important; font-size: 0.9em; color: #6c6c6c !important; line-heig= ht: 1.5em;"> <span style=3D"color: #6c6c6c;"= > Blaine Brownell examines a= recent breakthrough in bioplastics, which could "redefine plastic as a muc= h more environmentally responsible material," he… </span> <a href=3D"https://click1.e.hw-commercialdesign.com/zwlgwpvfrmlkdlbpkbjlpkv= llvklmdbgcrsrqcwrbfpmsf_jrrtjssnbmwbmfjqjttss.html" xt=3D"SPCLICK" name=3D"= nnn33" style=3D"display: inline-block !important; color: #00aeed !important= ; text-decoration: none !important;" class=3D"moreLink" data-cms-ai=3D"0">= <span class=3D"moreLink" style=3D"display: inl= ine-block; color: #00aeed; text-decoration: none; text-transform: uppercase= ;"> Read More </span> </a> </p> </td> </tr> </tbody> </table> </td> </tr> </tbody> </table> </td> </tr> <tr> <td height=3D"18"> </td> </tr> <tr> <td width=3D"100%" colspan=3D"3" style=3D"border-collapse: collapse; mso-table-lspace: 0pt; mso-tabl= e-rspace: 0pt;"> <table width=3D"100%" cellspacing=3D"0" cellpadding=3D"0"> <tbody> <tr> <td class=3D"mobileColToRow extra-padding" width=3D"300= " valign=3D"top" style=3D"padding-left: 0; width: 300px;"> <div class=3D"mobileThumbnail" style=3D"width: 300p= x; overflow: hidden;"> <a href=3D"https://click1.e.hw-commercialdesign.com/nkjcrfgkqypnjptfnthpfng= ppgnpyjtcbqdqmbrqtkfypw_jrrtjssnbmwbmfjqjttss.html" xt=3D"SPCLICK" name=3D"= nnn34" style=3D"color:#000 !important; text-decoration: none !important;"= data-cms-ai=3D"0"><img src=3D"https://cdnassets.hw.net/dims4/GG/af37cec/21= 47483647/thumbnail/300x200%3E/quality/90/?url=3Dhttps%3A%2F%2Fcdnassets.hw.= net%2F5f%2Fc8%2Fc7d325b8426195098408ae890b53%2Fcotino-hero.jpg" width=3D"30= 0" height=3D"200" border=3D"0" alt=3D"Midcentury Modern Turns Into a Fairyt= ale at Storyliving by Disney" data-size=3D"promo_300x200"></a> =20= </div> </td> <td style=3D"border-collapse: collapse; mso-table-lspac= e: 0pt; mso-table-rspace: 0pt;"> <table class=3D"img-spacer" width=3D"12" align=3D"c= enter" style=3D"width: 12px; height: 0;"> <tr> <td> </td> </tr> </table> </td> <td class=3D"mobileColToRow" width=3D"303" colspan=3D"1= " rowspan=3D"1" valign=3D"top" style=3D"clear: both; padding-left: 0; "> <table width=3D"100%"> <tbody> <tr> <td class=3D"eyebrow" style=3D"color:= #ed1f24; padding-bottom: 5px;"> <p style=3D"display: inline-block= !important; color: #ed1f24 !important; margin-top: 0; margin-bottom: 0 !im= portant; font-size: 0.7em; font-weight: bold; text-transform: uppercase;"> <span style=3D"display: inline-= block; color: #ed1f24;"> A Critic's Notebook </span> </p> </td> </tr> <tr> <td style=3D"color: #000000 !important;= "> <h2 style=3D"display: inline-block= !important; color: #000000; margin-top: 0; margin-bottom: 0 !important;=20= font-size: 1.4em; font-weight: bold; line-height: 1.1em;"> <a href=3D"https://click1.e.hw-commercialdesign.com/bzzscfvzplqybqjfyjkqfyv= qqvyqlbjsnpgpmncpjzflqp_jrrtjssnbmwbmfjqjttss.html" xt=3D"SPCLICK" name=3D"= nnn35" style=3D"color: #000000 !important; text-decoration: none !important= ;" data-cms-ai=3D"0"> <span= style=3D"color: #000000; text-decoration: none;"> Midcentury Modern Turns= Into a Fairytale at Storyliving by Disney </span> </a> </h2> </td> </tr> <tr> <td style=3D"color: #6c6c6c !important;= "> <p style=3D"margin-top: 0; margin-b= ottom: 0 !important; font-size: 0.9em; color: #6c6c6c !important; line-heig= ht: 1.5em;"> <span style=3D"color: #6c6c6c;"= > Aaron Betsky explores Cotino= , the first in what the company envisions as a series of planned residentia= l communities. </span> <a href=3D"https://click1.e.hw-commercialdesign.com/ymmpbqyvslgncgfqnfrgqny= ggynglcfpwskstwbsfvqlgl_jrrtjssnbmwbmfjqjttss.html" xt=3D"SPCLICK" name=3D"= nnn36" style=3D"display: inline-block !important; color: #00aeed !important= ; text-decoration: none !important;" class=3D"moreLink" data-cms-ai=3D"0">= <span class=3D"moreLink" style=3D"display: inl= ine-block; color: #00aeed; text-decoration: none; text-transform: uppercase= ;"> Read More </span> </a> </p> </td> </tr> </tbody> </table> </td> </tr> </tbody> </table> </td> </tr> <tr> <td height=3D"18"> </td> </tr> <tr> <td width=3D"600" valign=3D"top" align=3D"center" style=3D"padding-bottom: 20px; border-bottom: 3px solid #000;"></td= > </tr> <tr> <td height=3D"10"> </td> </tr><tr> <td style=3D"color: #000000 !important;"><h2 style=3D"displ= ay: inline-block !important; color: #000000; margin-top: 0; margin-bottom:= 0 !important; font-size: 1.0em; font-weight: bold; line-height: 1.1em;">= <span style=3D"color: #ed1f24; text-decoration: none;"> Upcoming Events:= </span></h2></td> </tr> <tr> <td height=3D"10"> </td> </tr> <tr> <td style=3D"color: #000000 !important;= "> <h2 style=3D"display: inline-block= !important; color: #000000; margin-top: 0; margin-bottom: 0 !important;=20= font-size: .9em; font-weight: bold; line-height: 1.1em;"> <a href=3D"https://click1.e.hw-commercialdesign.com/lzmfwgshmknrqndgrdpngrs= nnsrnkqdflmjmclwmdhgkng_jrrtjssnbmwbmfjqjttss.html" name=3D"nnn50" style=3D= "color: #000000 !important; text-decoration: none !important;" data-cms-ai= =3D"0"> <span style=3D"color= : #000000; text-decoration: none;"> Architect Connections</a= > — Jun 5-6, 2023 | Beacon Grand, San Francisco, CA=20 </span> </a> </h2> </td> </tr> =09=09=09=09 =09=09=09=09 <tr> <td style=3D"color: #6c6c6c !important;= "> <p style=3D"margin-top: 0; margin-b= ottom: 0 !important; font-size: 0.8em; color: #6c6c6c !important; line-heig= ht: 1.5em;"> <span style=3D"color: #6c6c6c;"= > <b>Grow Your Network at Archi= tect Connections</b><br/>Get matched through double opt-in meetings this=20= June. Find your next partner, client, supplier, or solution provider. YOU= set the agenda, ask the questions… </span> <h2 style=3D"display:= inline-block !important; color: #000000; margin-top: 0; margin-bottom: 0= !important; font-size: 0.8em; font-weight: bold; line-height: 1.1em;"><a= href=3D"https://click1.e.hw-commercialdesign.com/qnwjpsydmwfthfvstvqfstyff= ytfwhvjcmgmrcpmvdswfv_jrrtjssnbmwbmfjqjttss.html" name=3D"nnn51" style=3D"c= olor: #000000 !important; text-decoration: none !important;" data-cms-ai=3D= "0"> <span class=3D"moreLink= " style=3D"display: inl= ine-block; color: #00aeed; text-decoration: none; text-transform: uppercase= ;">Register Now</span> </a></h2></td> </tr> =20 =09=09=09=09=09=09=09 =09=09=09=09=09=09<tr> <td width=3D"600" valign=3D"top" align=3D"center" style=3D"padding-bottom: 20px; border-bottom: 3px solid #000;"></td= > </tr> </tr> =20 </tr> =20 =20 =09=09=09=09=09=09=09 =09=09=09=09=09 =20 =09=09=09=09=09 =20 =09=09=09=09=09=09=09 =09=09=09=09=09=09=09 </tr> =20 <tr> <td class=3D"mobileSpecialLinks" width=3D"600" style=3D"padding-top:=20= 10px; padding-bottom: 20px;" valign=3D"top"> <span style=3D"margin-top: 0; margin-right: 0; margin-bottom: 0;=20= margin-left: 0; padding-top: 0; padding-right: 0; padding-bottom: 0; paddin= g-left: 0; list-style-type: none;"> =20 =20 <span class=3D"" style=3D"margin-left: 0;"> <a href=3D"https://click1.e.hw-commercialdesign.com/abdvtdrlmkpnspydnyzpdnr= pprnpksyvcmhmgctmyldkph_jrrtjssnbmwbmfjqjttss.html" name=3D"nnn56" style=3D= "color: #ed1f24 !important; text-decoration: none !important;" class=3D"sp= ecial-link" target=3D"_blank" data-cms-ai=3D"0"> <span= class=3D"special-link" style=3D"color: #ed1f24 !important; font-size:= 1.0em !important;"> Advertise </span> </a> <br /> <span class=3D"" style=3D"margin-left: 0;"> <a href=3D"https://click1.e.hw-commercialdesign.com/wfwtnvkjdlsbzswvbwqsvbk= sskbslzwthdgdmhndwjvlss_jrrtjssnbmwbmfjqjttss.html" name=3D"nnn57" style=3D= "color: #ed1f24 !important; text-decoration: none !important;" class=3D"sp= ecial-link" target=3D"_blank" data-cms-ai=3D"0"> <span= class=3D"special-link" style=3D"color: #ed1f24 !important; font-size:= 1.0em !important;"> Contact Us </span> </a> =20 =20 </td> </tr> <tr> =20 <table align=3D"center" width=3D"100%" border=3D"0" cellspacing=3D"= 0" cellpadding=3D"0"> <tr> <td> <p style=3D"text-align: center; margin-top: 0; margin-b= ottom: 5px !important; font-size: 1.25em; font-weight: bold; font-style:=20= italic;"> Follow Us </p> </td> </tr> <tr> <td style=3D"text-align: center; padding-left: 5px; padding= -right: 5px;"> <span style=3D"display: inline-block;"> <a name=3D"" style=3D"text-decoration: none;"= href=3D"https://click1.e.hw-commercialdesign.com/mwnzbympcqdlsdtyltgdylmdd= mldqstzjcncvjbctpyqdb_jrrtjssnbmwbmfjqjttss.html" data-cms-ai=3D"0"> <img src=3D"https://cdnassets.hw.net/91/86/377e5fc44ee487474f8ce468e54e/twi= tter-social-icon-circle-resize.png" width=3D"35" height=3D"35" border=3D"0"= > </a> </span> <span> </span> <span style=3D"display: inline-block;"> <a name=3D"" style=3D"text-decoration: none;"= href=3D"https://click1.e.hw-commercialdesign.com/uyfzpwvchqfsmfgwsgbfwsvff= vsfqmgzjhnhkjphgcwqfm_jrrtjssnbmwbmfjqjttss.html" data-cms-ai=3D"0"> <img src=3D"https://cdnassets.hw.net/51/b1/8422958f420fa89dec46e141ef33/fac= ebook-resize.png" width=3D"35" height=3D"35" border=3D"0"> =20= </a> </span> <span> </span> <span style=3D"display: inline-block;"> <a name=3D"" style=3D"text-decoration: none;"= href=3D"https://click1.e.hw-commercialdesign.com/zzwgwpvfrmlkdlbpkbjlpkvll= vklmdbgcrsrqcwrbfpmlf_jrrtjssnbmwbmfjqjttss.html" data-cms-ai=3D"0"> <img src=3D"https://cdnassets.hw.net/39/2f/1a3453ae432b833ad88dee73260d/lin= kedin-resize.png" width=3D"35" height=3D"35" border=3D"0"> =20= </a> </span> <span> </span> <span style=3D"display: inline-block;"> <a name=3D"" style=3D"text-decoration: none;"= href=3D"https://click1.e.hw-commercialdesign.com/nykcrfgkqypnjptfnthpfngpp= gnpyjtcbqdqmbrqtkfyrw_jrrtjssnbmwbmfjqjttss.html" data-cms-ai=3D"0"> <img src=3D"https://cdnassets.hw.net/dd/11/e9739a9547fca36c636a7fba9279/ins= tagram-resize.png" width=3D"35" height=3D"35" border=3D"0"> =20= </a> </span> <span> </span> <span style=3D"display: inline-block;"> <a name=3D"" style=3D"text-decoration: none;"= href=3D"https://click1.e.hw-commercialdesign.com/zpzgwpvfrmlkdlbpkbjlpkvll= vklmdbgcrsrqcwrbfpmwr_jrrtjssnbmwbmfjqjttss.html" data-cms-ai=3D"0"> <img src=3D"https://cdnassets.hw.net/f3/05/5205782847ab99e767d07c999f52/pin= terest-resize.png" width=3D"35" height=3D"35" border=3D"0"> =20= </a> </span> =20 </td> </tr> </table> </td> </tr> <tr> <td width=3D"600" style=3D"padding-top: 15px; text-align: center; clear= : both;"> =20 <span style=3D"padding-bottom: 10px; font-family: Arial, Helvet= ica, sans-serif; font-size: 1.0em;"> <a href=3D"https://click1.e.hw-commercialdesign.com/xhdnjhkcdvbtsbphtplbhtk= bbktbvspnydrdqyjdpchvjv_jrrtjssnbmwbmfjqjttss.html" name=3D"nnn64" style=3D= "text-decoration: underline !important; color: #00aeed !important;" target= =3D"_blank" data-cms-ai=3D"0">AIA</a> =20 </span> </td> </tr> <tr> <td style=3D"height: 5px; line-height: 0; overflow: hidden; clear: both= ;"> =20 </td> </tr> <tr> <td width=3D"615" style=3D"padding-top: 10px; padding-bottom: 10px; tex= t-align: center; clear: both;"> <p style=3D"margin-top: 0; margin-botto= m:10px; font-size: 0.6em; color: #777 !important;">=20 To make sure you continue to receive our e-mails in your inbox (not in your= bulk or junk folders), please add architectnewswire@e.hw-commercialdesign.= com to your address book or safe sender list. </p> =20 =20 <p style=3D"margin-top: 0; margin-bottom:10px;= font-size: 0.6em; color: #777 !important;"> <a href=3D"https://click1.e.hw-commercialdesign= =2Ecom/rnrhtnylcrvpwvknpkfvnpyvvypvrwkhscgcbstcklnrtn_jrrtjssnbmwbmfjqjttss= =2Ehtml?a=3Delvis%40ebaarchitects.org" style=3D"color:#00aeef !important;= text-decoration: none !important;" data-cms-ai=3D"0">Click Here</a> to uns= ubscribe from ARCHITECT Newswire.</p> <p style=3D"margin-top: 0; margin-bottom:10px; font-size: 0.6em; color: #77= 7 !important;"> =20 =20 =09=09 =20 =20 =09=09 <p style=3D"margin-top: 0; margin-bottom:0; font-= size: 0.6em; color: #777 !important;">=C2=A9 Zonda Media, a Delaware corpor= ation. All Rights Reserved. Republication or re-dissemination of this newsl= etter's content is expressly prohibited without the written permission of= <a href=3D"https://click1.e.hw-commercialdesign.com/yqqpbqyvslgncgfqnfrgqn= yggynglcfpwskstwbsfvqlbf_jrrtjssnbmwbmfjqjttss.html">Zonda Media, a Delawar= e corporation.</a> </p><p style=3D"margin-top: 0; margin-bottom:0; font-siz= e: 0.6em; color: #777 !important;"> Zonda Media, a Delaware corporation | 1152 15th St. NW | Suite 850 | Washin= gton, DC 20005-5811</p> =09=09=09=09=09=09 </td> </tr> </table> </td> </tr> </table> <style type=3D"text/css"> /* Forces Outlook.com to display emails at full width */ .ExternalClass, .ExternalClass p, .ExternalClass span, .ExternalClass= font, .ExternalClass td, .ExternalClass div { line-height: 100%; } .ReadMsgBody { width: 100%; } .ExternalClass { width: 100%; line-height: 100%; } .ExternalClass p { margin-bottom: 0 !important; } /* Override AOL defaults */ body {font-family:Helvetica, Arial, sans-serif;font-size:12pt;margin:= 0;} th {font-size:12pt;} td {color: #6c6c6c;} td.eyebrow p a= [href]= { color: #ed1f24 !important; } /*Yahoo adds span.yshortcuts inside all links*/ a:link, span.yshortcuts { color: #000; /* Link color must be set inline for Gmail*/ background-color: none; border: none; text-decoration: none; } /* Overrides Outlook.com Contextual Highlighting */ span { color: #6c6c6c; border-bottom-width: 0; border-bottom-style: none; } p a:link, p span.yshortcuts { text-decoration: underline; } p a:active, p a:visited, p span.yshortcuts:active { text-decoration: underline; } a:active, a:visited, span.yshortcuts:active { color: #000; background-color: none; border: none; text-decoration: none; } a:hover, span.yshortcuts:hover, span.yshortcuts:focus { text-decoration: underline; } a.special-link, span.special-link { color: #f01e27 !important; text-decoration: none !important; } a.moreLink, span.moreLink, p a= [href]= { color: #00aeed !important; text-decoration: none !important; } h1 { color: #00aeed !important; text-decoration: none !important; } h1, h2, h3, h4, h5, h6, p, span { font-family: Arial, Helvetica, sans-serif; } h2, h4, h5 { color: #000 !important; /* Override Hotmail and Yahoo head tag colo= rs - Must also be set inline */ } h3 { color: #fff !important; } h6 { color: #777 !important; } .quote { color: #00adef !important; } p { margin-bottom: 0 !important; } .footertext { color: #777 !important; } table { border-collapse: collapse; } .MsoNormal { padding-bottom: 0 } /* =3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D= =3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D= =3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D= =3D=3D Mobile =3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D= =3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D= =3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D= =3D=3D */ table= [class=3D"mobileWrapper"]= { width: 650px !important; } table= [class=3D"mobileContent"]= { width: 615px !important; background-color: #ffffff !important; } table= [class=3D"mobileContent"]= td= [class=3D"50-50"]= > table { /*width: 300px !important;*/ max-width: 100% !important; } /*table= [class=3D"mobileContent"]= td= [class=3D"50-50"]= table= [align=3D"left"]= td{ padding-right: 12px !important; }*/ table.mobileContent td.mobileLogo { display: block !important; } table.mobileContent tr.mobileMobileLogo { display: none !important; text-align: left; } table.mobileContent td.mobileSocial img { margin: 0 !important; } table.mobileContent td.mobileSocial td { display: inline-block !important; width: auto !important; } table.mobileContent td.mobileAdwrapper img { border-style: none !important; } table.mobileContent td.extra-padding { padding-top: 5px !important; padding-bottom: 5px !important; } table.mobileContent td.extra-padding-bottom{ padding-bottom:18px !important; } @media only screen and (max-width: 614px) { table= [class=3D"mobileWrapper"]= { display: block !important; width: 350px !important; height: auto !important; padding: 0 15px !important } table= [class=3D"mobileContent"]= , table= [class=3D"mobileContent"]= table, table= [class=3D"mobileContent"]= thead, table= [class=3D"mobileContent"]= tbody, table= [class=3D"mobileContent"]= tfoot, table= [class=3D"mobileContent"]= th, table= [class=3D"mobileContent"]= td, table= [class=3D"mobileContent"]= tr, table= [class=3D"mobileContent"]= div.mobileThumbnail { display: block !important; width: 100% !important; height: auto !important; } table= [class=3D"mobileContent"]= td= [class=3D"50-50"]= > table{ width: 100% !important; float: none !important; clear: both !important; margin: 0 auto !important; } table= [class=3D"mobileContent"]= table= [class=3D"img-spacer"]= { display: none !important; } table= [class=3D"mobileContent"]= td= [class=3D"50-50"]= > table= [class=3D"spacer"]= { width: 100% !important; height: 10px !important; } table= [class=3D"mobileContent"]= td= [class=3D"50-50"]= > table td= [class=3D"mobileAdwrapper"]= { text-align: center !important; } table= [class=3D"mobileContent"]= td= [class=3D"50-50"]= table= [align=3D"left"]= td{ padding-right: 0 !important; } table= [class=3D"mobileContent"]= h3 { min-height: 12px !important; height: auto !important; width: 100% !important; } table= [class=3D"mobileContent"]= .mobileLogo { height: auto; } table= [class=3D"mobileContent"]= td.mobileAdwrapper { padding-left: 0 !important; text-align: center !important; } table= [class=3D"mobileContent"]= div.mobileThumbnail { display: block !important; width: 300px !important; max-height: 200px !important; height: auto !important; overflow: hidden !important; margin: 0 auto; } table= [class=3D"mobileContent"]= div.mobileThumbnail img { width: 300px !important; height: auto !important; } table= [class=3D"mobileContent"]= .mobileLogoImg { width: 300px !important; height: auto !important; } table= [class=3D"mobileContent"]= .mobileLeaderboardAd { padding-left: 0 !important; padding-right: 0 !important; } table= [class=3D"mobileContent"]= .mobileLeaderboardAd div { width: 100% !important; } table= [class=3D"mobileContent"]= .mobileLeaderboardAd img { width: 100% !important; height: auto !important; } table= [class=3D"mobileContent"]= .colSeparator { display: none; } table= [class=3D"mobileContent"]= .mobileDate { border-top: none !important; height: 35px; } table= [class=3D"mobileContent"]= .mobileSpecialLinks td { padding-top: 0 !important; padding-bottom: 20px !important; } table= [class=3D"mobileContent"]= .mobileSpecialLinks ul { font-size: 0; text-align: center; } table= [class=3D"mobileContent"]= .mobileSpecialLinks li { /*padding-right: 25px;*/ font-size: 15px; display: inline-block; } table= [class=3D"mobileContent"]= .mobileSpecialLinks li.mobileFirstChild { /*padding-right: 0px;*/ float: left; } table= [class=3D"mobileContent"]= .mobileSpecialLinks li.mobileLastChild { /*padding-right: 0px;*/ float: right; } table= [class=3D"mobileContent"]= .mobileSpecialLinks li.mobileArrow { background-image: url('http://images.hanleywood.com/newsletters= /arrow-right.png'); width: 14px; height: 14px; float: left; margin-right: 2px; } table= [class=3D"mobileContent"]= .mobileSpecialLinks li.mobileArrow img { display: none; } table= [class=3D"mobileContent"]= .mobileMagazine { float: left; width: 145px; padding-right: 10px; border-bottom: none !important; } table= [class=3D"mobileContent"]= .mobileMagazine div { border-bottom: none !important; } table= [class=3D"mobileContent"]= .mobileMagImg, table= [class=3D"mobileContent"]= .mobileMagImg img { width: 145px !important; height: auto !important; } table= [class=3D"mobileContent"]= .mobilePublicationLinks { float: left; width: 145px; } table= [class=3D"mobileContent"]= .mobilePublicationLinks + tr { clear: both; } table= [class=3D"mobileContent"]= .mobileColToRow { margin-bottom: 10px; } table= [class=3D"mobileContent"]= .mobileSocialIcons { width: 100% border-top: 2px solid #000; height: 34px; padding: 2px 0 !important; } table= [class=3D"mobileContent"]= td.mobileSocial { padding-bottom: 5px; } /* mobile hacks for the current issue before footer */ table= [class=3D"mobileContent"]= tr.mobileMobileLogo td > div { width: 100% !important; overflow: auto !important; height: auto !important; line-height: normal !important; } table= [class=3D"mobileContent"]= tr.mobileMobileLogo { display: block !important; } table= [class=3D"mobileContent"]= tr.mobileMobileLogo td > div { display: block !important; height: auto !important; width: auto !important; } table= [class=3D"mobileContent"]= .utilityLinks a.special-link span.special-link { font-size: 0.6em !important; } table= [class=3D"mobileContent"]= td.mobileSocial img { display: inline-block !important; } table= [class=3D"mobileContent"]= td.extra-padding { padding-top: 0px !important; padding-bottom: 0px !important; } table= [class=3D"mobileContent"]= .zero-height { height: 0px !important; } table= [class=3D"mobileContent"]= div.mobileImage { width: 300px !important; overflow: hidden !important; height: 200px !important; } table= [class=3D"mobileContent"]= div.mobileImage img { width: 300px !important; height: auto !important; } table= [class=3D"mobileContent"]= span#mobileChart { display: block; width: 300px !important; height: 200px !important; } table= [class=3D"mobileContent"]= .colSeparator { display: none; } table= [class=3D"mobileContent"]= .mobileLeftCol { display: inline-block; } table= [class=3D"mobileContent"]= .mobileRightCol { width: 80px !important; float: right; } table= [class=3D"mobileContent"]= .mobileLogo td { display: table-cell; } table= [class=3D"mobileContent"]= .mobileHeader img { max-width: 300px; height: auto; } table= [class=3D"mobileContent"]= .mobileHeader, table= [class=3D"mobileContent"]= .mobileHeader table, table= [class=3D"mobileContent"]= .mobileHeader td { height: auto !important; } table= [class=3D"mobileContent"]= .mobileHeader table { margin-top: 5px !important; margin-bottom: 5px !important; } table= [class=3D"mobileContent"]= .mobileHeaderAd, table= [class=3D"mobileContent"]= .mobileHeaderAd table, table= [class=3D"mobileContent"]= .mobileHeaderAd tbody, table= [class=3D"mobileContent"]= .mobileHeaderAd td, table= [class=3D"mobileContent"]= .mobileHeaderAd tr, table= [class=3D"mobileContent"]= .mobileHeaderAd h6 { width: 80px !important; } table= [class=3D"mobileContent"]= .mobileHeaderAd h6 { font-size: .55em !important; -webkit-text-size-adjust: none; -moz-text-size-adjust: none; -ms-text-size-adjust: none; } table= [class=3D"mobileContent"]= .mobileHeaderAd { ] border: none !important; position: absolute; top: -40px; } table= [class=3D"mobileContent"]= .mobileHeaderAd img { max-width: 80px; height: auto; } table= [class=3D"mobileContent"]= .mobileFooterAd img { width: 300px !important; height: auto !important; } td= [id=3D"mobileHideMagazineIssue"]= { display: none !important;=20 } table= [id=3D"mobileRelative"]= { position: relative !important; top: 50px !important; } } </style> <img src=3D"https://13b96a.efeedbacktrk.com/bcqscfvzplqybqjfyjkqfyvqqvyqlbj= snpgpmncpjzflll_jrrtjssnbmwbmfjqjttss.gif" width=3D"0" height=3D"0" alt=3D"= "> <span style=3D"display: none;"><a href=3D'https://click1.e.hw-commercial= design.com/mytzbympcqdlsdtyltgdylmddmldqstzjcncvjbctpyqbn_jrrtjssnbmwbmfjqj= ttss.html?a=3DA73B9126-8643-4D63-B66B-6284AE151CE7&b=3Dqhsvsnndmf'>Link</a>= </span> </body> </html>