OwlCyberSecurity - MANAGER
Edit File: 1685466307.M608402P2454385.server237.web-hosting.com,S=115977,W=119295
Return-Path: <bounce-fdnbhqqydnwnhrggwdnrjbnsbqqwcghtydsn@communication.hanleywood.com> Delivered-To: elvis@ebaarchitects.org Received: from server237.web-hosting.com by server237.web-hosting.com with LMTP id QFwJI8MsdmRxcyUA7Ypugw (envelope-from <bounce-fdnbhqqydnwnhrggwdnrjbnsbqqwcghtydsn@communication.hanleywood.com>) for <elvis@ebaarchitects.org>; Tue, 30 May 2023 13:05:07 -0400 Return-path: <bounce-fdnbhqqydnwnhrggwdnrjbnsbqqwcghtydsn@communication.hanleywood.com> Envelope-to: elvis@ebaarchitects.org Delivery-date: Tue, 30 May 2023 13:05:07 -0400 Received: from mail4.communication.hanleywood.com ([96.46.128.145]:41514) by server237.web-hosting.com with esmtps (TLS1.2) tls TLS_ECDHE_RSA_WITH_AES_256_GCM_SHA384 (Exim 4.95) (envelope-from <bounce-fdnbhqqydnwnhrggwdnrjbnsbqqwcghtydsn@communication.hanleywood.com>) id 1q42mL-00AQqM-Bh for elvis@ebaarchitects.org; Tue, 30 May 2023 13:05:07 -0400 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; s=class; d=e.hw-commercialdesign.com; h=Date:From:Reply-To:To:Message-ID:Subject:MIME-Version:Content-Type: Content-Transfer-Encoding:List-Unsubscribe; i=architectnewswire@e.hw-commercialdesign.com; bh=7viSebRvdRbEbaK/Bwi2KzV0RmzLwg+6GtDy699BYSk=; b=U9yZOLnFLycjmz+kbR9i38EWjRZ4hlHfK+UVhRiU9DL697jbPstT48dHbZ3Ho3doqOywSuVVeAdL zs3EfbyW2t9E+KgdiR4JIXfhWx/hBg2aYpQPIqRTn316uKcp9o7m6kkBAdJmtUnS8Whyp+1rrJot wVOGabGn0rZwCf5Yp6M= DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; s=class; d=communication.hanleywood.com; h=Date:From:Reply-To:To:Message-ID:Subject:MIME-Version:Content-Type: Content-Transfer-Encoding:List-Unsubscribe; bh=7viSebRvdRbEbaK/Bwi2KzV0RmzLwg+6GtDy699BYSk=; b=gHedqKZ4iagpgp2GphQ7mJHD6dpc9gMdhfyvYOJI+Azhky+2V+wmbEShADjxlf9vsTXoC3uO5qL1 DUXwjWKSuItBMO21TQaRtK612HD8S+YfbCh0CyazQNf+ekZ3syanI1aWWPJlztY7kWBu74FAnCVa m5F7+nvnCgdCW4BGv2o= Received: by mail4.communication.hanleywood.com id heom982uaico for <elvis@ebaarchitects.org>; Tue, 30 May 2023 12:04:20 -0500 (envelope-from <bounce-fdnbhqqydnwnhrggwdnrjbnsbqqwcghtydsn@communication.hanleywood.com>) Date: Tue, 30 May 2023 12:04:20 -0500 (CDT) From: Architect Newswire <architectnewswire@e.hw-commercialdesign.com> Reply-To: Hanley Wood <updates@communication.hanleywood.com> To: friend <elvis@ebaarchitects.org> Message-ID: <1082320773.6099152.1685466260395@communication.hanleywood.com> Subject: This Week in Tech & Culture: Edible Architecture and Sustainable, Locally Sourced Foods MIME-Version: 1.0 Content-Type: text/html; charset=UTF-8 Content-Transfer-Encoding: quoted-printable X-HANW: ybkkfcsssmkmnslsnqlglslksv pbqyvslgcgfqfrgqyggyglcfpwskstwbnfqmmvsgngqcbbnsgckfglfmm cbfqlqkgv List-Unsubscribe: <mailto:unsub-4300916-63877-A73B912686434D63B66B6284AE151CE7@communication.hanleywood.com> X-Spam-Status: No, score=0.4 X-Spam-Score: 4 X-Spam-Bar: / X-Ham-Report: Spam detection software, running on the system "server237.web-hosting.com", has NOT identified this incoming email as spam. The original message has been attached to this so you can view it or label similar future email. If you have any questions, see root\@localhost for details. Content preview: Architect Newswire AIA: Cool April Billings Reflect Wider Economic Uncertainty Our email domains are changing soon! To ensure you continue to receive your newsletters, please whitelist: @zonda-newsletters.com Content analysis details: (0.4 points, 5.0 required) pts rule name description ---- ---------------------- -------------------------------------------------- 0.0 URIBL_BLOCKED ADMINISTRATOR NOTICE: The query to URIBL was blocked. See http://wiki.apache.org/spamassassin/DnsBlocklists#dnsbl-block for more information. [URIs: hw-commercialdesign.com] -0.0 SPF_PASS SPF: sender matches SPF record 0.2 HEADER_FROM_DIFFERENT_DOMAINS From and EnvelopeFrom 2nd level mail domains are different 0.1 URI_HEX URI: URI hostname has long hexadecimal sequence 0.0 HTML_MESSAGE BODY: HTML included in message 0.0 HTML_IMAGE_RATIO_04 BODY: HTML has a low ratio of text to image area 0.1 MIME_HTML_ONLY BODY: Message only has text/html MIME parts -0.1 DKIM_VALID Message has at least one valid DKIM or DK signature 0.1 DKIM_SIGNED Message has a DKIM or DK signature, not necessarily valid -0.1 DKIM_VALID_AU Message has a valid DKIM or DK signature from author's domain 0.0 T_KAM_HTML_FONT_INVALID Test for Invalidly Named or Formatted Colors in HTML -0.0 T_SCC_BODY_TEXT_LINE No description available. 0.0 T_FILL_THIS_FORM_SHORT Fill in a short form with personal information X-Spam-Flag: NO =20 <!DOCTYPE html PUBLIC "-//W3C//DTD XHTML 1.0 Strict//EN" "http://www.w3= =2Eorg/TR/xhtml1/DTD/xhtml1-strict.dtd"> <html xmlns=3D"http://www.w3.org/1999/xhtml" xmlns:v=3D"urn:schemas-microsoft-com:vml" xmlns:o=3D"urn:schemas-microsoft-com:office:office"> <head profile=3D"http://www.w3.org/2005/10/profile"> <title>Architect Newswire</title> <meta http-equiv=3D"content-type" content=3D"charset=3Dutf-8"/> <meta http-equiv=3D"content-language" content=3D"en-us"/> <meta name=3D"viewport" content=3D"width=3Ddevice-width, initial-scale= =3D1.0, maximum-scale=3D2.0, user-scalable=3Dyes"/> <style type=3D"text/css"> /* Forces Outlook.com to display emails at full width */ .ExternalClass, .ExternalClass p, .ExternalClass span, .ExternalClass= font, .ExternalClass td, .ExternalClass div { line-height: 100%; } .ReadMsgBody { width: 100%; } .ExternalClass { width: 100%; line-height: 100%; } .ExternalClass p { margin-bottom: 0 !important; } /* Override AOL defaults */ body {font-family:Helvetica, Arial, sans-serif;font-size:12pt;margin:= 0;} th {font-size:12pt;} td {color: #6c6c6c;} td.eyebrow p a= [href]= { color: #ed1f24 !important; } /*Yahoo adds span.yshortcuts inside all links*/ a:link, span.yshortcuts { color: #000; /* Link color must be set inline for Gmail*/ background-color: none; border: none; text-decoration: none; } /* Overrides Outlook.com Contextual Highlighting */ span { color: #6c6c6c; border-bottom-width: 0; border-bottom-style: none; } p a:link, p span.yshortcuts { text-decoration: underline; } p a:active, p a:visited, p span.yshortcuts:active { text-decoration: underline; } a:active, a:visited, span.yshortcuts:active { color: #000; background-color: none; border: none; text-decoration: none; } a:hover, span.yshortcuts:hover, span.yshortcuts:focus { text-decoration: underline; } a.special-link, span.special-link { color: #f01e27 !important; text-decoration: none !important; } a.moreLink, span.moreLink, p a= [href]= { color: #00aeed !important; text-decoration: none !important; } h1 { color: #00aeed !important; text-decoration: none !important; } h1, h2, h3, h4, h5, h6, p, span { font-family: Arial, Helvetica, sans-serif; } h2, h4, h5 { color: #000 !important; /* Override Hotmail and Yahoo head tag colo= rs - Must also be set inline */ } h3 { color: #fff !important; } h6 { color: #777 !important; } .quote { color: #00adef !important; } p { margin-bottom: 0 !important; } .footertext { color: #777 !important; } table { border-collapse: collapse; } .MsoNormal { padding-bottom: 0 } /* =3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D= =3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D= =3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D= =3D=3D Mobile =3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D= =3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D= =3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D= =3D=3D */ table= [class=3D"mobileWrapper"]= { width: 650px !important; } table= [class=3D"mobileContent"]= { width: 615px !important; background-color: #ffffff !important; } table= [class=3D"mobileContent"]= td= [class=3D"50-50"]= > table { /*width: 300px !important;*/ max-width: 100% !important; } /*table= [class=3D"mobileContent"]= td= [class=3D"50-50"]= table= [align=3D"left"]= td{ padding-right: 12px !important; }*/ table.mobileContent td.mobileLogo { display: block !important; } table.mobileContent tr.mobileMobileLogo { display: none !important; text-align: left; } table.mobileContent td.mobileSocial img { margin: 0 !important; } table.mobileContent td.mobileSocial td { display: inline-block !important; width: auto !important; } table.mobileContent td.mobileAdwrapper img { border-style: none !important; } table.mobileContent td.extra-padding { padding-top: 5px !important; padding-bottom: 5px !important; } table.mobileContent td.extra-padding-bottom{ padding-bottom:18px !important; } @media only screen and (max-width: 614px) { table= [class=3D"mobileWrapper"]= { display: block !important; width: 350px !important; height: auto !important; padding: 0 15px !important } table= [class=3D"mobileContent"]= , table= [class=3D"mobileContent"]= table, table= [class=3D"mobileContent"]= thead, table= [class=3D"mobileContent"]= tbody, table= [class=3D"mobileContent"]= tfoot, table= [class=3D"mobileContent"]= th, table= [class=3D"mobileContent"]= td, table= [class=3D"mobileContent"]= tr, table= [class=3D"mobileContent"]= div.mobileThumbnail { display: block !important; width: 100% !important; height: auto !important; } table= [class=3D"mobileContent"]= td= [class=3D"50-50"]= > table{ width: 100% !important; float: none !important; clear: both !important; margin: 0 auto !important; } table= [class=3D"mobileContent"]= table= [class=3D"img-spacer"]= { display: none !important; } table= [class=3D"mobileContent"]= td= [class=3D"50-50"]= > table= [class=3D"spacer"]= { width: 100% !important; height: 10px !important; } table= [class=3D"mobileContent"]= td= [class=3D"50-50"]= > table td= [class=3D"mobileAdwrapper"]= { text-align: center !important; } table= [class=3D"mobileContent"]= td= [class=3D"50-50"]= table= [align=3D"left"]= td{ padding-right: 0 !important; } table= [class=3D"mobileContent"]= h3 { min-height: 12px !important; height: auto !important; width: 100% !important; } table= [class=3D"mobileContent"]= .mobileLogo { height: auto; } table= [class=3D"mobileContent"]= td.mobileAdwrapper { padding-left: 0 !important; text-align: center !important; } table= [class=3D"mobileContent"]= div.mobileThumbnail { display: block !important; width: 300px !important; max-height: 200px !important; height: auto !important; overflow: hidden !important; margin: 0 auto; } table= [class=3D"mobileContent"]= div.mobileThumbnail img { width: 300px !important; height: auto !important; } table= [class=3D"mobileContent"]= .mobileLogoImg { width: 300px !important; height: auto !important; } table= [class=3D"mobileContent"]= .mobileLeaderboardAd { padding-left: 0 !important; padding-right: 0 !important; } table= [class=3D"mobileContent"]= .mobileLeaderboardAd div { width: 100% !important; } table= [class=3D"mobileContent"]= .mobileLeaderboardAd img { width: 100% !important; height: auto !important; } table= [class=3D"mobileContent"]= .colSeparator { display: none; } table= [class=3D"mobileContent"]= .mobileDate { border-top: none !important; height: 35px; } table= [class=3D"mobileContent"]= .mobileSpecialLinks td { padding-top: 0 !important; padding-bottom: 20px !important; } table= [class=3D"mobileContent"]= .mobileSpecialLinks ul { font-size: 0; text-align: center; } table= [class=3D"mobileContent"]= .mobileSpecialLinks li { /*padding-right: 25px;*/ font-size: 15px; display: inline-block; } table= [class=3D"mobileContent"]= .mobileSpecialLinks li.mobileFirstChild { /*padding-right: 0px;*/ float: left; } table= [class=3D"mobileContent"]= .mobileSpecialLinks li.mobileLastChild { /*padding-right: 0px;*/ float: right; } table= [class=3D"mobileContent"]= .mobileSpecialLinks li.mobileArrow { background-image: url('http://images.hanleywood.com/newsletters= /arrow-right.png'); width: 14px; height: 14px; float: left; margin-right: 2px; } table= [class=3D"mobileContent"]= .mobileSpecialLinks li.mobileArrow img { display: none; } table= [class=3D"mobileContent"]= .mobileMagazine { float: left; width: 145px; padding-right: 10px; border-bottom: none !important; } table= [class=3D"mobileContent"]= .mobileMagazine div { border-bottom: none !important; } table= [class=3D"mobileContent"]= .mobileMagImg, table= [class=3D"mobileContent"]= .mobileMagImg img { width: 145px !important; height: auto !important; } table= [class=3D"mobileContent"]= .mobilePublicationLinks { float: left; width: 145px; } table= [class=3D"mobileContent"]= .mobilePublicationLinks + tr { clear: both; } table= [class=3D"mobileContent"]= .mobileColToRow { margin-bottom: 10px; } table= [class=3D"mobileContent"]= .mobileSocialIcons { width: 100% border-top: 2px solid #000; height: 34px; padding: 2px 0 !important; } table= [class=3D"mobileContent"]= td.mobileSocial { padding-bottom: 5px; } /* mobile hacks for the current issue before footer */ table= [class=3D"mobileContent"]= tr.mobileMobileLogo td > div { width: 100% !important; overflow: auto !important; height: auto !important; line-height: normal !important; } table= [class=3D"mobileContent"]= tr.mobileMobileLogo { display: block !important; } table= [class=3D"mobileContent"]= tr.mobileMobileLogo td > div { display: block !important; height: auto !important; width: auto !important; } table= [class=3D"mobileContent"]= .utilityLinks a.special-link span.special-link { font-size: 0.6em !important; } table= [class=3D"mobileContent"]= td.mobileSocial img { display: inline-block !important; } table= [class=3D"mobileContent"]= td.extra-padding { padding-top: 0px !important; padding-bottom: 0px !important; } table= [class=3D"mobileContent"]= .zero-height { height: 0px !important; } table= [class=3D"mobileContent"]= div.mobileImage { width: 300px !important; overflow: hidden !important; height: 200px !important; } table= [class=3D"mobileContent"]= div.mobileImage img { width: 300px !important; height: auto !important; } table= [class=3D"mobileContent"]= span#mobileChart { display: block; width: 300px !important; height: 200px !important; } table= [class=3D"mobileContent"]= .colSeparator { display: none; } table= [class=3D"mobileContent"]= .mobileLeftCol { display: inline-block; } table= [class=3D"mobileContent"]= .mobileRightCol { width: 80px !important; float: right; } table= [class=3D"mobileContent"]= .mobileLogo td { display: table-cell; } table= [class=3D"mobileContent"]= .mobileHeader img { max-width: 300px; height: auto; } table= [class=3D"mobileContent"]= .mobileHeader, table= [class=3D"mobileContent"]= .mobileHeader table, table= [class=3D"mobileContent"]= .mobileHeader td { height: auto !important; } table= [class=3D"mobileContent"]= .mobileHeader table { margin-top: 5px !important; margin-bottom: 5px !important; } table= [class=3D"mobileContent"]= .mobileHeaderAd, table= [class=3D"mobileContent"]= .mobileHeaderAd table, table= [class=3D"mobileContent"]= .mobileHeaderAd tbody, table= [class=3D"mobileContent"]= .mobileHeaderAd td, table= [class=3D"mobileContent"]= .mobileHeaderAd tr, table= [class=3D"mobileContent"]= .mobileHeaderAd h6 { width: 80px !important; } table= [class=3D"mobileContent"]= .mobileHeaderAd h6 { font-size: .55em !important; -webkit-text-size-adjust: none; -moz-text-size-adjust: none; -ms-text-size-adjust: none; } table= [class=3D"mobileContent"]= .mobileHeaderAd { ] border: none !important; position: absolute; top: -40px; } table= [class=3D"mobileContent"]= .mobileHeaderAd img { max-width: 80px; height: auto; } table= [class=3D"mobileContent"]= .mobileFooterAd img { width: 300px !important; height: auto !important; } td= [id=3D"mobileHideMagazineIssue"]= { display: none !important;=20 } table= [id=3D"mobileRelative"]= { position: relative !important; top: 50px !important; } } </style> </head> <body style=3D"background-color: #f2f3f5; color: #6c6c6c; font-size: 12pt;= margin-top: 0; margin-right: 0; margin-bottom: 0; margin-left: 0; padding-= top: 0; padding-right: 0; padding-bottom: 0; padding-left: 0;"> <table align=3D"center" width=3D"650" border=3D"0" cellspacing=3D"0" cellpa= dding=3D"0" class=3D"mobileWrapper" style=3D"width: 650px; margin-top: 0; margin-right: auto; margin-bot= tom: 0; margin-left: auto; padding: 0; font-family: Arial, Helvetica, sans-= serif; color: #6c6c6c; background-color: #fff;"> <tr> <td width=3D"615" style=3D"padding: 0; margin: 0; width: 615px;"> <table class=3D"mobileContent" id=3D"" width=3D"615" border=3D"= 0" cellspacing=3D"0" cellpadding=3D"0" align=3D"center" style=3D"margin-top: 0; margin-right: auto; margin-botto= m: 0; margin-left: auto; padding-top: 0; padding-bottom: 0;"> =20 <tr> <td style=3D"color: #6c6c6c !important;"> <p style=3D"margin-top: 0; margin-bottom: 20px !imp= ortant; font-size: 0.85em; color: #6c6c6c !important; "> <strong> <span style=3D"color:#6c6c6c !important;"> AIA: Cool April Billings Reflect Wider Econo= mic Uncertainty</span> </strong> </p> </td> </tr> <tr> <td align=3D"center" class=3D"mobileLeaderboardAd" width=3D"600" style=3D"padding-right: 6px; padding-top: 17px; padding-bottom: 3px= ; padding-left: 6px; text-align: center;"> <div style=3D"width: 600px; margin-right: auto; margin-left: auto;"= > <!--POWERINBOX 600x90--> <div class=3D"pi_17416 powerinbox"> <!-- domain: rs-stripe.architectmagazine.com --> <!--= [if (gte mso 9)|(IE)]= ><table align=3D"center" cellpadding=3D"0" cellspacing=3D"0" width=3D"600">= <tr><td><!= [endif]= --> <table width=3D"100%" border=3D"0" cellspacing=3D"0" cellpadding=3D"0"=20= style=3D"width: 100%; max-width: 600px;"> <tbody> <tr> <td width=3D"100%"> <a href=3D"https://click1.e.hw-commercialdesign.com/nwqcrfgkqypnj= ptfnthpfngppgnpyjtcbqdqmbrqdwrdkq_nfytfwwkqpnqpjdtpytww.html?a=3Delvis%40eb= aarchitects.org&b=3D63877" style=3D"border-style: none; outline: none; text= -decoration: none;" target=3D"_blank" ref=3D"nofollow" data-cms-ai=3D"0"><i= mg alt=3D"" height=3D"auto" src=3D"https://rs-stripe.architectmagazine.com/= stripe/image?cs_email=3Delvis@ebaarchitects.org&cs_sendid=3D63877&cs_esp=3D= postup&cs_offset=3D0&cs_stripeid=3D17416&dfp_nl_send_date=3D05/26/2023" sty= le=3D"width: 100%; max-width: 600px;display: block; border: 0; height: auto= ; line-height: 100%; outline: none; text-decoration: none;" width=3D"600"><= /a> </td> </tr> </tbody> </table> <!--= [if (gte mso 9)|(IE)]= ></td></tr></table><!= [endif]= --> </div> <!--POWERINBOX 600x90--> </div> </td> </tr> <tr> <td width=3D"100%" valign=3D"top" align=3D"center" height=3D"30" style= =3D"height: 30px;"> =20 </td> </tr> <tr> <td width=3D"100%" valign=3D"top" align=3D"center" style=3D"padding-bottom: 20px; border-bottom: 5px solid #000;"> <a href=3D"https://click1.e.hw-commercialdesign.com/gwyjlgsmcytdntkgdkq= tgdsttsdtynkjfcrcpflcrwlrmy_nfytfwwkqpnqpjdtpytww.html" name=3D"" style=3D"= color: #000; text-decoration: none;" data-cms-ai=3D"0"> <img src=3D"https://cdnassets.hw.net/5b/f2/0fcd74f94927883a36c1c3aa7f4c/arc= hitect-newsletter-config.png" width=3D"341" height=3D"57" border=3D"0" vspa= ce=3D"8" alt=3D"Architect Newswire" style=3D"vertical-align: bottom; max-wi= dth: 456px; height: auto; margin-top: 0px; margin-bottom: 0" class=3D"mobil= eLogoImg"/> </a> </td> </tr> =09=09=09=09 =09=09=09=09 =09=09=09=09<tr> <td height=3D"10"> </td> </tr> <tr> <td style=3D"color: #000000 !important;= " align=3D"center"> <h2 style=3D"display: inline-block= !important; color: #000000; margin-top: 0; margin-bottom: 0 !important;=20= font-size: 1em; font-weight: bold; line-height: 1.1em;"> <a href=3D"#"></a><img style=3D"position:relative" src=3D"https://cdnassets= =2Ehw.net/a9/90/594de14543d9b1b6b779fbca877c/envelope-icon-for-newseltter-h= eader.png" width=3D"51" height=3D"39" border=3D"0" alt=3D"envelope" data-si= ze=3D"promo_150x50"> =09=09=09=09=09=09=09=09=09=09=09<div style=3D"position:relative; color:=20= #000000; font-family:Arial, Helvetica, sans-serif; font-size:18x; font-weig= ht:bold;letter-spacing:0px; line-height:20px;text-align:center;"><br>Our=20= email domains are changing soon! To ensure you continue to receive your new= sletters, please whitelist: @zonda-newsletters.com</div> </h2> </td> =09=09=09 =09<tr> =09=09=09=09=09<td> =09=09=09=09=09=09<br> =09=09=09=09=09=09<hr color=3D#000000 size=3D"5px" noshade> =09=09=09=09=09</td> =09=09 =09=09=09=09</tr> </tr> <tr> <td width=3D"100%" valign=3D"top" class=3D"extra-paddin= g"> <table width=3D"100%" border=3D"0" cellspacing=3D"0= " cellpadding=3D"0"> <tr> <td width=3D"100%" colspan=3D"3" style=3D"border-collapse: collapse; mso-table-lspace: 0pt; mso-tabl= e-rspace: 0pt;"> <table width=3D"100%" cellspacing=3D"0" cellpadding=3D"0"> <tbody> <tr> <td class=3D"mobileColToRow extra-padding" width=3D"300= " valign=3D"top" style=3D"padding-left: 0; width: 300px;"> <div class=3D"mobileThumbnail" style=3D"width: 300p= x; overflow: hidden;"> <a href=3D"https://click1.e.hw-commercialdesign.com/hnblhbjfvqwzmwsbzsrwbzj= wwjzwqmsldvcvpdhvcnhcfb_nfytfwwkqpnqpjdtpytww.html" xt=3D"SPCLICK" name=3D"= nnn1" style=3D"color:#000 !important; text-decoration: none !important;"=20= data-cms-ai=3D"0"><img src=3D"https://cdnassets.hw.net/dims4/GG/e1cc9fa/214= 7483647/thumbnail/300x200%3E/quality/90/?url=3Dhttps%3A%2F%2Fcdnassets.hw.n= et%2F52%2Fc4%2Fccb1a28847238d52e697273ecff0%2Fjobs-abi-template-2021-2023-a= pril.jpg" width=3D"300" height=3D"200" border=3D"0" alt=3D"AIA: Cool April= Billings Reflect Wider Economic Uncertainty" data-size=3D"promo_300x200"><= /a> </div> </td> <td style=3D"border-collapse: collapse; mso-table-lspac= e: 0pt; mso-table-rspace: 0pt;"> <table class=3D"img-spacer" width=3D"12" align=3D"c= enter" style=3D"width: 12px; height: 0;"> <tr> <td> </td> </tr> </table> </td> <td class=3D"mobileColToRow" width=3D"303" colspan=3D"1= " rowspan=3D"1" valign=3D"top" style=3D"clear: both; padding-left: 0; "> <table width=3D"100%"> <tbody> <tr> <td class=3D"eyebrow" style=3D"color:= #ed1f24; padding-bottom: 5px;"> <p style=3D"display: inline-block= !important; color: #ed1f24 !important; margin-top: 0; margin-bottom: 0 !im= portant; font-size: 0.7em; font-weight: bold; text-transform: uppercase;"> <span style=3D"display: inline-= block; color: #ed1f24;"> Business </span> </p> </td> </tr> <tr> <td style=3D"color: #000000 !important;= "> <h2 style=3D"display: inline-block= !important; color: #000000; margin-top: 0; margin-bottom: 0 !important;=20= font-size: 1.4em; font-weight: bold; line-height: 1.1em;"> <a href=3D"https://click1.e.hw-commercialdesign.com/edtvzyjqrshfphtyftlhyfj= hhjfhsptvcrbrwczrbdzbqt_nfytfwwkqpnqpjdtpytww.html" xt=3D"SPCLICK" name=3D"= nnn2" style=3D"color: #000000 !important; text-decoration: none !important;= " data-cms-ai=3D"0"> <span= style=3D"color: #000000; text-decoration: none;"> AIA: Cool April Billing= s Reflect Wider Economic Uncertainty </span> </a> </h2> </td> </tr> <tr> <td style=3D"color: #6c6c6c !important;= "> <p style=3D"margin-top: 0; margin-b= ottom: 0 !important; font-size: 0.9em; color: #6c6c6c !important; line-heig= ht: 1.5em;"> <span style=3D"color: #6c6c6c;"= > The American Institute of=20= Architects Architecture Billings Index measured 48.5 in April, dipping back= below a score of 50.0. </span> <a href=3D"https://click1.e.hw-commercialdesign.com/zzsgwpvfrmlkdlbpkbjlpkv= llvklmdbgcrsrqcwrszwsfs_nfytfwwkqpnqpjdtpytww.html" xt=3D"SPCLICK" name=3D"= nnn3" style=3D"display: inline-block !important; color: #00aeed !important;= text-decoration: none !important;" class=3D"moreLink" data-cms-ai=3D"0">= <span class=3D"moreLink" style=3D"display: inl= ine-block; color: #00aeed; text-decoration: none; text-transform: uppercase= ;"> Read More </span> </a> </p> </td> </tr> </tbody> </table> </td> </tr> </tbody> </table> </td> </tr> <tr> <td height=3D"18"> </td> </tr> <tr> <td width=3D"100%" colspan=3D"3" style=3D"border-collapse: collapse; mso-table-lspace: 0pt; mso-tabl= e-rspace: 0pt;"> <table width=3D"100%" cellspacing=3D"0" cellpadding=3D"0"> <tbody> <tr> <td class=3D"mobileColToRow extra-padding" width=3D"300= " valign=3D"top" style=3D"padding-left: 0; width: 300px;"> <div class=3D"mobileThumbnail" style=3D"width: 300p= x; overflow: hidden;"> <a href=3D"https://click1.e.hw-commercialdesign.com/oflcrjsqtzldmlkjdkgljds= llsdlzmkcptwtnprtwfrwql_nfytfwwkqpnqpjdtpytww.html" xt=3D"SPCLICK" name=3D"= nnn4" style=3D"color:#000 !important; text-decoration: none !important;"=20= data-cms-ai=3D"0"><img src=3D"https://cdnassets.hw.net/dims4/GG/e084f02/214= 7483647/thumbnail/300x200%3E/quality/90/?url=3Dhttps%3A%2F%2Fcdnassets.hw.n= et%2F66%2F4d%2F088795d64b1babbbef19236fcb35%2Fkbkg-midpoint-hero.jpg" width= =3D"300" height=3D"200" border=3D"0" alt=3D"Designing for a Green Future"= data-size=3D"promo_300x200"></a> </div> </td> <td style=3D"border-collapse: collapse; mso-table-lspac= e: 0pt; mso-table-rspace: 0pt;"> <table class=3D"img-spacer" width=3D"12" align=3D"c= enter" style=3D"width: 12px; height: 0;"> <tr> <td> </td> </tr> </table> </td> <td class=3D"mobileColToRow" width=3D"303" colspan=3D"1= " rowspan=3D"1" valign=3D"top" style=3D"clear: both; padding-left: 0; "> <table width=3D"100%"> <tbody> <tr> <td class=3D"eyebrow" style=3D"color:= #ed1f24; padding-bottom: 5px;"> <p style=3D"display: inline-block= !important; color: #ed1f24 !important; margin-top: 0; margin-bottom: 0 !im= portant; font-size: 0.7em; font-weight: bold; text-transform: uppercase;"> <span style=3D"display: inline-= block; color: #ed1f24;"> brought to you by KBKG </span> </p> </td> </tr> <tr> <td style=3D"color: #000000 !important;= "> <h2 style=3D"display: inline-block= !important; color: #000000; margin-top: 0; margin-bottom: 0 !important;=20= font-size: 1.4em; font-weight: bold; line-height: 1.1em;"> <a href=3D"https://click1.e.hw-commercialdesign.com/rjthtnylcrvpwvknpkfvnpy= vvypvrwkhscgcbstcgjtglt_nfytfwwkqpnqpjdtpytww.html" xt=3D"SPCLICK" name=3D"= nnn5" style=3D"color: #000000 !important; text-decoration: none !important;= " data-cms-ai=3D"0"> <span= style=3D"color: #000000; text-decoration: none;"> Designing for a Green=20= Future </span> </a> </h2> </td> </tr> <tr> <td style=3D"color: #6c6c6c !important;= "> <p style=3D"margin-top: 0; margin-b= ottom: 0 !important; font-size: 0.9em; color: #6c6c6c !important; line-heig= ht: 1.5em;"> <span style=3D"color: #6c6c6c;"= > How architects can save on= taxes by designing energy=E2=80=93efficient buildings. </span> <a href=3D"https://click1.e.hw-commercialdesign.com/zzdgwpvfrmlkdlbpkbjlpkv= llvklmdbgcrsrqcwrszwsfd_nfytfwwkqpnqpjdtpytww.html" xt=3D"SPCLICK" name=3D"= nnn6" style=3D"display: inline-block !important; color: #00aeed !important;= text-decoration: none !important;" class=3D"moreLink" data-cms-ai=3D"0">= <span class=3D"moreLink" style=3D"display: inl= ine-block; color: #00aeed; text-decoration: none; text-transform: uppercase= ;"> Read More </span> </a> </p> </td> </tr> </tbody> </table> </td> </tr> </tbody> </table> </td> </tr> <tr> <td height=3D"18"> </td> </tr> <tr> <td class=3D"50-50" width=3D"100%" colspan=3D"3" style=3D"border-collapse: collapse; mso-table-lspace: 0pt; mso-tabl= e-rspace: 0pt; padding-bottom: 18px;"> <table width=3D"100%" border=3D"0" cellspacing=3D"0" cellpadding=3D= "0"> <tr> <td class=3D"mobileColToRow" align=3D"left" valign=3D"top" style=3D"border-= collapse: collapse; mso-table-lspace: 0pt; mso-table-rspace: 0pt; margin-to= p: 0; margin-right: 0; margin-bottom: 0; margin-left: 0; padding-top: 0;=20= padding-right: 0; padding-bottom: 0; padding-left: 0;"> <table border=3D"0" cellspacing=3D"0" cellpadding=3D"0" width=3D"300"> <tbody> <tr> <th style=3D"color: #000 !important; float: left; padding-left:= 5px; padding-bottom: 5px; font: 9pt arial;"> =20 </th> </tr> <tr> <td class=3D"mobileColToRow extra-padding" rowspan=3D"1" colspan=3D"1" valign=3D"top" style=3D"width: 300px; padding-left: 0px; "> <div class=3D"mobileThumbnail" style=3D"width: 300px; overflow: hidden;"> <a href=3D"https://click1.e.hw-commercialdesign.com/zzfgwpvfrmlkdlbpkbjlpkv= llvklmdbgcrsrqcwrszwsff_nfytfwwkqpnqpjdtpytww.html" xt=3D"SPCLICK" name=3D"= nnn7" style=3D"color:#000 !important; text-decoration: none !important;"=20= data-cms-ai=3D"0"><img src=3D"https://cdnassets.hw.net/dims4/GG/02a249d/214= 7483647/thumbnail/300x200%3E/quality/90/?url=3Dhttps%3A%2F%2Fcdnassets.hw.n= et%2Fa4%2F5a%2Fae81acf047d38709a3e9b5231243%2Fedible-small.jpg" width=3D"30= 0" height=3D"200" border=3D"0" alt=3D"This Week in Tech & Culture: Edible= Architecture and Sustainable, Locally Sourced Foods" data-size=3D"promo_30= 0x200"></a> </div> </td> </tr> <tr> <td style=3D"font-size: 0"> <table class=3D"img-spacer" height=3D"3" align=3D"center"= style=3D"height: 3px; font-size: 0;"><tr><td> </td></tr></table> </td> </tr> <tr> <td class=3D"eyebrow-padding eyebrow" style=3D"color: #ed1f24;= padding-bottom: 5px;"> <p style=3D"display: inline-block !important; color: #ed1f2= 4 !important; margin-top: 0; margin-bottom: 0 !important; font-size: 0.7em;= font-weight: bold; text-transform: uppercase;"> <span style=3D"display: inline-block; color: #ed1f24;">= Technology</span> </p> </td> </tr> <tr> <td style=3D"color: #000000 !important;"> <h2 style=3D"display: inline-block !important; color: #0000= 00; margin-top: 0; margin-bottom: 0 !important; font-size: 1.4em; font-weig= ht: bold; line-height: 1.1em;"> <a href=3D"https://click1.e.hw-commercialdesign.com/lqkfwgshmknrqndgrdpngrs= nnsrnkqdflmjmclwmjzwnzz_nfytfwwkqpnqpjdtpytww.html" xt=3D"SPCLICK" name=3D"= nnn8" style=3D"color: #000000 !important; text-decoration: none !important;= " data-cms-ai=3D"0"> <span style=3D"color: #000000;= text-decoration: none;">This Week in Tech & Culture: Edible Architecture= and Sustainable, Locally Sourced Foods</span> </a> </h2> </td> </tr> <tr> <td style=3D"color: #6c6c6c !important;"> <p style=3D"margin-top: 0; margin-bottom: 0 !important; fon= t-size: 0.9em; color: #6c6c6c !important; line-height: 1.5em;"> <span style=3D"color: #6c6c6c;">Plus, a new collaborati= on between Safdie Architects and Epic Games, a new book about the relations= hip between architecture and calcium, the Loewe…</span> <a href=3D"https://click1.e.hw-commercialdesign.com/izvtnvpcyhdwzdbvwbkdvwp= ddpwdhzbtrymyqrnymgndgy_nfytfwwkqpnqpjdtpytww.html" xt=3D"SPCLICK" name=3D"= nnn9" style=3D"display: inline-block !important; color: #00aeed !important;= text-decoration: none !important;" class=3D"moreLink" data-cms-ai=3D"0">= <span class=3D"moreLink" style=3D"display: inline-b= lock; color: #00aeed; text-decoration: none; text-transform: uppercase;">Re= ad More</span> </a> </p> </td> </tr> </tbody> </table> </td> <td> <table class=3D"spacer" width=3D"12" align=3D"c= enter" style=3D"width: 12px; height: 0;"> <tr> <td> </td> </tr> </table> </td> <td class=3D"mobileAdwrapper" align=3D"right" valign=3D"top" style=3D"borde= r-collapse: collapse; mso-table-lspace: 0pt; mso-table-rspace: 0pt; margin-= top: 0; margin-right: 0; margin-bottom: 0; margin-left: 0; padding-top: 0;= padding-right: 0; padding-bottom: 0; padding-left: 0;"> <table align=3D"center" style=3D"font: 7pt arial" bgcolor=3D"#ffffff"= border=3D"0" cellspacing=3D"0" cellpadding=3D"0" width=3D"300"> <tbody> <tr> <th style=3D"color:#000000 !important; float: left; padding-lef= t: 5px; padding-bottom: 5px;"> Advertisement </th> </tr> <tr> <td> <!-- POWERINBOX 300x250 --> <div class=3D"pi_17417 powerinbox"> <!-- domain: rs-stripe.architectmagazine.com --> <table width=3D"300" border=3D"0" cellpadding=3D"0" cellspacing=3D"0"> <tr> <td align=3D"center"> <a href=3D"https://click1.e.hw-commercialdesign.com/slczsvwpbrktlkc= vtcfkvtwkkwtkrlczgbmbhgsbmjskjr_nfytfwwkqpnqpjdtpytww.html?a=3Delvis%40ebaa= rchitects.org&b=3D63877" style=3D"border-style: none; outline: none; text-d= ecoration: none;" target=3D"_blank" ref=3D"nofollow" data-cms-ai=3D"0"><img= alt=3D"" height=3D"250" src=3D"https://rs-stripe.architectmagazine.com/str= ipe/image?cs_email=3Delvis@ebaarchitects.org&cs_sendid=3D63877&cs_esp=3Dpos= tup&cs_offset=3D0&cs_stripeid=3D17417&dfp_nl_send_date=3D05/26/2023" style= =3D"display: block; border: 0; height: auto; line-height: 100%; outline:=20= none; text-decoration: none;" width=3D"300"></a> </td> </tr> </table> </div> <!-- POWERINBOX 300x250 --> </td> </tr> </tbody> </table> </td> </tr> </table> </td> </tr> <tr> <td height=3D"18"> </td> </tr> <tr> <td width=3D"100%" colspan=3D"3" style=3D"border-collapse: collapse; mso-table-lspace: 0pt; mso-tabl= e-rspace: 0pt;"> <table width=3D"100%" cellspacing=3D"0" cellpadding=3D"0"> <tbody> <tr> <td class=3D"mobileColToRow extra-padding" width=3D"300= " valign=3D"top" style=3D"padding-left: 0; width: 300px;"> <div class=3D"mobileThumbnail" style=3D"width: 300p= x; overflow: hidden;"> <a href=3D"https://click1.e.hw-commercialdesign.com/wzgtnvkjdlsbzswvbwqsvbk= sskbslzwthdgdmhndgfnsfv_nfytfwwkqpnqpjdtpytww.html" xt=3D"SPCLICK" name=3D"= nnn10" style=3D"color:#000 !important; text-decoration: none !important;"= data-cms-ai=3D"0"><img src=3D"https://cdnassets.hw.net/dims4/GG/3a7eb73/21= 47483647/thumbnail/300x200%3E/quality/90/?url=3Dhttps%3A%2F%2Fcdnassets.hw.= net%2F13%2F11%2Ffd67ad3e45fba817e07c2e00c863%2Fadobestock-25883469.jpeg"=20= width=3D"300" height=3D"200" border=3D"0" alt=3D"New Initiative Takes Aim= at Unsheltered Homelessness" data-size=3D"promo_300x200"></a> =20= </div> </td> <td style=3D"border-collapse: collapse; mso-table-lspac= e: 0pt; mso-table-rspace: 0pt;"> <table class=3D"img-spacer" width=3D"12" align=3D"c= enter" style=3D"width: 12px; height: 0;"> <tr> <td> </td> </tr> </table> </td> <td class=3D"mobileColToRow" width=3D"303" colspan=3D"1= " rowspan=3D"1" valign=3D"top" style=3D"clear: both; padding-left: 0; "> <table width=3D"100%"> <tbody> <tr> <td class=3D"eyebrow" style=3D"color:= #ed1f24; padding-bottom: 5px;"> <p style=3D"display: inline-block= !important; color: #ed1f24 !important; margin-top: 0; margin-bottom: 0 !im= portant; font-size: 0.7em; font-weight: bold; text-transform: uppercase;"> <span style=3D"display: inline-= block; color: #ed1f24;"> AFFORDABLE HOUSING FINANCE </span> </p> </td> </tr> <tr> <td style=3D"color: #000000 !important;= "> <h2 style=3D"display: inline-block= !important; color: #000000; margin-top: 0; margin-bottom: 0 !important;=20= font-size: 1.4em; font-weight: bold; line-height: 1.1em;"> <a href=3D"https://click1.e.hw-commercialdesign.com/wzstnvkjdlsbzswvbwqsvbk= sskbslzwthdgdmhndgfnsfw_nfytfwwkqpnqpjdtpytww.html" xt=3D"SPCLICK" name=3D"= nnn11" style=3D"color: #000000 !important; text-decoration: none !important= ;" data-cms-ai=3D"0"> <span= style=3D"color: #000000; text-decoration: none;"> New Initiative Takes Aim= at Unsheltered Homelessness </span> </a> </h2> </td> </tr> <tr> <td style=3D"color: #6c6c6c !important;= "> <p style=3D"margin-top: 0; margin-b= ottom: 0 !important; font-size: 0.9em; color: #6c6c6c !important; line-heig= ht: 1.5em;"> <span style=3D"color: #6c6c6c;"= > ALL INside will embed a federal= official in participating communities, beginning with Chicago, Dallas, Los= Angeles, the Phoenix metro, Seattle, and… </span> <a href=3D"https://click1.e.hw-commercialdesign.com/jfqzqjcnbrmwfmtjwthmjwc= mmcwmrftzpbvbkpqbvsqmsv_nfytfwwkqpnqpjdtpytww.html" xt=3D"SPCLICK" name=3D"= nnn12" style=3D"display: inline-block !important; color: #00aeed !important= ; text-decoration: none !important;" class=3D"moreLink" data-cms-ai=3D"0">= <span class=3D"moreLink" style=3D"display: inl= ine-block; color: #00aeed; text-decoration: none; text-transform: uppercase= ;"> Read More </span> </a> </p> </td> </tr> </tbody> </table> </td> </tr> </tbody> </table> </td> </tr> <tr> <td height=3D"18"> </td> </tr> <tr> <td width=3D"100%" colspan=3D"3" style=3D"border-collapse: collapse; mso-table-lspace: 0pt; mso-tabl= e-rspace: 0pt;"> <table width=3D"100%" cellspacing=3D"0" cellpadding=3D"0"> <tbody> <tr> <td class=3D"mobileColToRow extra-padding" width=3D"300= " valign=3D"top" style=3D"padding-left: 0; width: 300px;"> <div class=3D"mobileThumbnail" style=3D"width: 300p= x; overflow: hidden;"> <a href=3D"https://click1.e.hw-commercialdesign.com/zddgwpvfrmlkdlbpkbjlpkv= llvklmdbgcrsrqcwrszwlzl_nfytfwwkqpnqpjdtpytww.html" xt=3D"SPCLICK" name=3D"= nnn13" style=3D"color:#000 !important; text-decoration: none !important;"= data-cms-ai=3D"0"><img src=3D"https://cdnassets.hw.net/dims4/GG/c7a4a08/21= 47483647/thumbnail/300x200%3E/quality/90/?url=3Dhttps%3A%2F%2Fcdnassets.hw.= net%2F48%2Ffa%2F1399765e4c38a3112ead7978e536%2Fproxy-23.jpg" width=3D"300"= height=3D"200" border=3D"0" alt=3D"What Are the Ingredients for Making a= Successful Master Plan?" data-size=3D"promo_300x200"></a> =20= </div> </td> <td style=3D"border-collapse: collapse; mso-table-lspac= e: 0pt; mso-table-rspace: 0pt;"> <table class=3D"img-spacer" width=3D"12" align=3D"c= enter" style=3D"width: 12px; height: 0;"> <tr> <td> </td> </tr> </table> </td> <td class=3D"mobileColToRow" width=3D"303" colspan=3D"1= " rowspan=3D"1" valign=3D"top" style=3D"clear: both; padding-left: 0; "> <table width=3D"100%"> <tbody> <tr> <td class=3D"eyebrow" style=3D"color:= #ed1f24; padding-bottom: 5px;"> <p style=3D"display: inline-block= !important; color: #ed1f24 !important; margin-top: 0; margin-bottom: 0 !im= portant; font-size: 0.7em; font-weight: bold; text-transform: uppercase;"> <span style=3D"display: inline-= block; color: #ed1f24;"> BUILDER </span> </p> </td> </tr> <tr> <td style=3D"color: #000000 !important;= "> <h2 style=3D"display: inline-block= !important; color: #000000; margin-top: 0; margin-bottom: 0 !important;=20= font-size: 1.4em; font-weight: bold; line-height: 1.1em;"> <a href=3D"https://click1.e.hw-commercialdesign.com/aslvtdrlmkpnspydnyzpdnr= pprnpksyvcmhmgctmhbtpbt_nfytfwwkqpnqpjdtpytww.html" xt=3D"SPCLICK" name=3D"= nnn14" style=3D"color: #000000 !important; text-decoration: none !important= ;" data-cms-ai=3D"0"> <span= style=3D"color: #000000; text-decoration: none;"> What Are the Ingredients= for Making a Successful Master Plan? </span> </a> </h2> </td> </tr> <tr> <td style=3D"color: #6c6c6c !important;= "> <p style=3D"margin-top: 0; margin-b= ottom: 0 !important; font-size: 0.9em; color: #6c6c6c !important; line-heig= ht: 1.5em;"> <span style=3D"color: #6c6c6c;"= > Zonda=E2=80=99s Mollie Carmi= chael shares features in the top-performing master plans as well as emergin= g trends resonating with consumers in the first… </span> <a href=3D"https://click1.e.hw-commercialdesign.com/hfnlhbjfvqwzmwsbzsrwbzj= wwjzwqmsldvcvpdhvcnhwnm_nfytfwwkqpnqpjdtpytww.html" xt=3D"SPCLICK" name=3D"= nnn15" style=3D"display: inline-block !important; color: #00aeed !important= ; text-decoration: none !important;" class=3D"moreLink" data-cms-ai=3D"0">= <span class=3D"moreLink" style=3D"display: inl= ine-block; color: #00aeed; text-decoration: none; text-transform: uppercase= ;"> Read More </span> </a> </p> </td> </tr> </tbody> </table> </td> </tr> </tbody> </table> </td> </tr> <tr> <td height=3D"18"> </td> </tr> <tr> <td class=3D"50-50" width=3D"100%" colspan=3D"3" style=3D"border-collapse: collapse; mso-table-lspace: 0pt; mso-tabl= e-rspace: 0pt; padding-bottom: 18px;"> <table width=3D"100%" border=3D"0" cellspacing=3D"0" cellpadding=3D= "0"> <tr> <td class=3D"mobileColToRow" align=3D"left" valign=3D"top" style=3D"border-= collapse: collapse; mso-table-lspace: 0pt; mso-table-rspace: 0pt; margin-to= p: 0; margin-right: 0; margin-bottom: 0; margin-left: 0; padding-top: 0;=20= padding-right: 0; padding-bottom: 0; padding-left: 0;"> <table border=3D"0" cellspacing=3D"0" cellpadding=3D"0" width=3D"300"> <tbody> <tr> <th style=3D"color: #000 !important; float: left; padding-left:= 5px; padding-bottom: 5px; font: 9pt arial;"> =20 </th> </tr> <tr> <td class=3D"mobileColToRow extra-padding" rowspan=3D"1" colspan=3D"1" valign=3D"top" style=3D"width: 300px; padding-left: 0px; "> <div class=3D"mobileThumbnail" style=3D"width: 300px; overflow: hidden;"> <a href=3D"https://click1.e.hw-commercialdesign.com/wjdtnvkjdlsbzswvbwqsvbk= sskbslzwthdgdmhndgfnsfj_nfytfwwkqpnqpjdtpytww.html" xt=3D"SPCLICK" name=3D"= nnn16" style=3D"color:#000 !important; text-decoration: none !important;"= data-cms-ai=3D"0"><img src=3D"https://cdnassets.hw.net/dims4/GG/a4c1202/21= 47483647/thumbnail/300x200%3E/quality/90/?url=3Dhttps%3A%2F%2Fcdnassets.hw.= net%2F24%2F8c%2Faca1f7054bcc913e779f09d1974d%2Funtitled-1.jpg" width=3D"300= " height=3D"200" border=3D"0" alt=3D"USGBC-LA Hosts 22nd Annual Conference= and Expo" data-size=3D"promo_300x200"></a> </div> </td> </tr> <tr> <td style=3D"font-size: 0"> <table class=3D"img-spacer" height=3D"3" align=3D"center"= style=3D"height: 3px; font-size: 0;"><tr><td> </td></tr></table> </td> </tr> <tr> <td class=3D"eyebrow-padding eyebrow" style=3D"color: #ed1f24;= padding-bottom: 5px;"> <p style=3D"display: inline-block !important; color: #ed1f2= 4 !important; margin-top: 0; margin-bottom: 0 !important; font-size: 0.7em;= font-weight: bold; text-transform: uppercase;"> <span style=3D"display: inline-block; color: #ed1f24;">= Events</span> </p> </td> </tr> <tr> <td style=3D"color: #000000 !important;"> <h2 style=3D"display: inline-block !important; color: #0000= 00; margin-top: 0; margin-bottom: 0 !important; font-size: 1.4em; font-weig= ht: bold; line-height: 1.1em;"> <a href=3D"https://click1.e.hw-commercialdesign.com/sbvzsvwpbrktlkcvtcfkvtw= kkwtkrlczgbmbhgsbmjskbj_nfytfwwkqpnqpjdtpytww.html" xt=3D"SPCLICK" name=3D"= nnn17" style=3D"color: #000000 !important; text-decoration: none !important= ;" data-cms-ai=3D"0"> <span style=3D"color: #000000;= text-decoration: none;">USGBC-LA Hosts 22nd Annual Conference and Expo</sp= an> </a> </h2> </td> </tr> <tr> <td style=3D"color: #6c6c6c !important;"> <p style=3D"margin-top: 0; margin-bottom: 0 !important; fon= t-size: 0.9em; color: #6c6c6c !important; line-height: 1.5em;"> <span style=3D"color: #6c6c6c;">The U.S. Green Building= Council Los Angeles Chapter's annual event on May 18 featured seven keynot= e speakers, 12 workshops, 90 exhibitors, a…</span> <a href=3D"https://click1.e.hw-commercialdesign.com/ertvzyjqrshfphtyftlhyfj= hhjfhsptvcrbrwczrbdzhrr_nfytfwwkqpnqpjdtpytww.html" xt=3D"SPCLICK" name=3D"= nnn18" style=3D"display: inline-block !important; color: #00aeed !important= ; text-decoration: none !important;" class=3D"moreLink" data-cms-ai=3D"0">= <span class=3D"moreLink" style=3D"display: inline-b= lock; color: #00aeed; text-decoration: none; text-transform: uppercase;">Re= ad More</span> </a> </p> </td> </tr> </tbody> </table> </td> <td> <table class=3D"spacer" width=3D"12" align=3D"c= enter" style=3D"width: 12px; height: 0;"> <tr> <td> </td> </tr> </table> </td> <td class=3D"mobileAdwrapper" align=3D"right" valign=3D"top" style=3D"borde= r-collapse: collapse; mso-table-lspace: 0pt; mso-table-rspace: 0pt; margin-= top: 0; margin-right: 0; margin-bottom: 0; margin-left: 0; padding-top: 0;= padding-right: 0; padding-bottom: 0; padding-left: 0;"> <table align=3D"center" style=3D"font: 7pt arial" bgcolor=3D"#ffffff"= border=3D"0" cellspacing=3D"0" cellpadding=3D"0" width=3D"300"> <tbody> <tr> <th style=3D"color:#000000 !important; float: left; padding-lef= t: 5px; padding-bottom: 5px;"> Advertisement </th> </tr> <tr> <td> <!-- POWERINBOX 300x250 --> <div class=3D"pi_17418 powerinbox"> <!-- domain: rs-stripe.architectmagazine.com --> <table width=3D"300" border=3D"0" cellpadding=3D"0" cellspacing=3D"0"> <tr> <td align=3D"center"> <a href=3D"https://click1.e.hw-commercialdesign.com/vfhqjpdyfvgnmgk= pnkbgpndggdngvmkqcfhfzcjfhrjgfv_nfytfwwkqpnqpjdtpytww.html?a=3Delvis%40ebaa= rchitects.org&b=3D63877" style=3D"border-style: none; outline: none; text-d= ecoration: none;" target=3D"_blank" ref=3D"nofollow" data-cms-ai=3D"0"><img= alt=3D"" height=3D"250" src=3D"https://rs-stripe.architectmagazine.com/str= ipe/image?cs_email=3Delvis@ebaarchitects.org&cs_sendid=3D63877&cs_esp=3Dpos= tup&cs_offset=3D0&cs_stripeid=3D17418&dfp_nl_send_date=3D05/26/2023" style= =3D"display: block; border: 0; height: auto; line-height: 100%; outline:=20= none; text-decoration: none;" width=3D"300"></a> </td> </tr> </table> </div> <!-- POWERINBOX 300x250 --> </td> </tr> </tbody> </table> </td> </tr> </table> </td> </tr> <tr> <td height=3D"18"> </td> </tr> <tr> <td width=3D"100%" colspan=3D"3" style=3D"border-collapse: collapse; mso-table-lspace: 0pt; mso-tabl= e-rspace: 0pt;"> <table width=3D"100%" cellspacing=3D"0" cellpadding=3D"0"> <tbody> <tr> <td class=3D"mobileColToRow extra-padding" width=3D"300= " valign=3D"top" style=3D"padding-left: 0; width: 300px;"> <div class=3D"mobileThumbnail" style=3D"width: 300p= x; overflow: hidden;"> <a href=3D"https://click1.e.hw-commercialdesign.com/dtmldhzjtpmfsmrhfrkmhfz= mmzfmpsrlbtctwbdtcgdmth_nfytfwwkqpnqpjdtpytww.html" xt=3D"SPCLICK" name=3D"= nnn19" style=3D"color:#000 !important; text-decoration: none !important;"= data-cms-ai=3D"0"><img src=3D"https://cdnassets.hw.net/dims4/GG/9a85a64/21= 47483647/thumbnail/300x200%3E/quality/90/?url=3Dhttps%3A%2F%2Fcdnassets.hw.= net%2Fe2%2Fab%2Fccc5ab5644f4851ac7bd2dd9664e%2Fimg-2215.jpeg" width=3D"300"= height=3D"200" border=3D"0" alt=3D"Postcard From Venice: The Biennale Meet= s Reality" data-size=3D"promo_300x200"></a> </div> </td> <td style=3D"border-collapse: collapse; mso-table-lspac= e: 0pt; mso-table-rspace: 0pt;"> <table class=3D"img-spacer" width=3D"12" align=3D"c= enter" style=3D"width: 12px; height: 0;"> <tr> <td> </td> </tr> </table> </td> <td class=3D"mobileColToRow" width=3D"303" colspan=3D"1= " rowspan=3D"1" valign=3D"top" style=3D"clear: both; padding-left: 0; "> <table width=3D"100%"> <tbody> <tr> <td class=3D"eyebrow" style=3D"color:= #ed1f24; padding-bottom: 5px;"> <p style=3D"display: inline-block= !important; color: #ed1f24 !important; margin-top: 0; margin-bottom: 0 !im= portant; font-size: 0.7em; font-weight: bold; text-transform: uppercase;"> <span style=3D"display: inline-= block; color: #ed1f24;"> Venice Biennale </span> </p> </td> </tr> <tr> <td style=3D"color: #000000 !important;= "> <h2 style=3D"display: inline-block= !important; color: #000000; margin-top: 0; margin-bottom: 0 !important;=20= font-size: 1.4em; font-weight: bold; line-height: 1.1em;"> <a href=3D"https://click1.e.hw-commercialdesign.com/amtvtdrlmkpnspydnyzpdnr= pprnpksyvcmhmgctmhbtpmy_nfytfwwkqpnqpjdtpytww.html" xt=3D"SPCLICK" name=3D"= nnn20" style=3D"color: #000000 !important; text-decoration: none !important= ;" data-cms-ai=3D"0"> <span= style=3D"color: #000000; text-decoration: none;"> Postcard From Venice:= The Biennale Meets Reality </span> </a> </h2> </td> </tr> <tr> <td style=3D"color: #6c6c6c !important;= "> <p style=3D"margin-top: 0; margin-b= ottom: 0 !important; font-size: 0.9em; color: #6c6c6c !important; line-heig= ht: 1.5em;"> <span style=3D"color: #6c6c6c;"= > In his final day at the 2023= show preview, Ian Volner reflects on an event "determined to open itself= up to the world." </span> <a href=3D"https://click1.e.hw-commercialdesign.com/phdrcjwvhqlbdlyjbytljbw= llwblqdyrghmhkgchmfclhm_nfytfwwkqpnqpjdtpytww.html" xt=3D"SPCLICK" name=3D"= nnn21" style=3D"display: inline-block !important; color: #00aeed !important= ; text-decoration: none !important;" class=3D"moreLink" data-cms-ai=3D"0">= <span class=3D"moreLink" style=3D"display: inl= ine-block; color: #00aeed; text-decoration: none; text-transform: uppercase= ;"> Read More </span> </a> </p> </td> </tr> </tbody> </table> </td> </tr> </tbody> </table> </td> </tr> <tr> <td height=3D"18"> </td> </tr> <tr> <td width=3D"100%" colspan=3D"3" style=3D"border-collapse: collapse; mso-table-lspace: 0pt; mso-tabl= e-rspace: 0pt;"> <table width=3D"100%" cellspacing=3D"0" cellpadding=3D"0"> <tbody> <tr> <td class=3D"mobileColToRow extra-padding" width=3D"300= " valign=3D"top" style=3D"padding-left: 0; width: 300px;"> <div class=3D"mobileThumbnail" style=3D"width: 300p= x; overflow: hidden;"> <a href=3D"https://click1.e.hw-commercialdesign.com/fdycghtydsnwrnbhwbznhwt= nntwnsrbcpdjdlpgdjqgndn_nfytfwwkqpnqpjdtpytww.html" xt=3D"SPCLICK" name=3D"= nnn22" style=3D"color:#000 !important; text-decoration: none !important;"= data-cms-ai=3D"0"><img src=3D"https://cdnassets.hw.net/dims4/GG/fe57de4/21= 47483647/thumbnail/300x200%3E/quality/90/?url=3Dhttps%3A%2F%2Fcdnassets.hw.= net%2F0c%2Fb1%2F8eac2d22438da780453dbf8efdb6%2Ftiprise-iron-tree-ai-weiwei-= photo-by-james-florio.jpg" width=3D"300" height=3D"200" border=3D"0" alt=3D= "A Portal to Mountain Majesty: Montana=E2=80=99s Tippet Rise Art Center"=20= data-size=3D"promo_300x200"></a> </div> </td> <td style=3D"border-collapse: collapse; mso-table-lspac= e: 0pt; mso-table-rspace: 0pt;"> <table class=3D"img-spacer" width=3D"12" align=3D"c= enter" style=3D"width: 12px; height: 0;"> <tr> <td> </td> </tr> </table> </td> <td class=3D"mobileColToRow" width=3D"303" colspan=3D"1= " rowspan=3D"1" valign=3D"top" style=3D"clear: both; padding-left: 0; "> <table width=3D"100%"> <tbody> <tr> <td class=3D"eyebrow" style=3D"color:= #ed1f24; padding-bottom: 5px;"> <p style=3D"display: inline-block= !important; color: #ed1f24 !important; margin-top: 0; margin-bottom: 0 !im= portant; font-size: 0.7em; font-weight: bold; text-transform: uppercase;"> <span style=3D"display: inline-= block; color: #ed1f24;"> A Critic's Notebook </span> </p> </td> </tr> <tr> <td style=3D"color: #000000 !important;= "> <h2 style=3D"display: inline-block= !important; color: #000000; margin-top: 0; margin-bottom: 0 !important;=20= font-size: 1.4em; font-weight: bold; line-height: 1.1em;"> <a href=3D"https://click1.e.hw-commercialdesign.com/jrszqjcnbrmwfmtjwthmjwc= mmcwmrftzpbvbkpqbvsqmbq_nfytfwwkqpnqpjdtpytww.html" xt=3D"SPCLICK" name=3D"= nnn23" style=3D"color: #000000 !important; text-decoration: none !important= ;" data-cms-ai=3D"0"> <span= style=3D"color: #000000; text-decoration: none;"> A Portal to Mountain Maj= esty: Montana=E2=80=99s Tippet Rise Art Center </span> </a> </h2> </td> </tr> <tr> <td style=3D"color: #6c6c6c !important;= "> <p style=3D"margin-top: 0; margin-b= ottom: 0 !important; font-size: 0.9em; color: #6c6c6c !important; line-heig= ht: 1.5em;"> <span style=3D"color: #6c6c6c;"= > Aaron Betsky tours the 12,500= -acre ranch, which showcases sculptures and performance art. </span> <a href=3D"https://click1.e.hw-commercialdesign.com/ylspbqyvslgncgfqnfrgqny= ggynglcfpwskstwbskmbgsc_nfytfwwkqpnqpjdtpytww.html" xt=3D"SPCLICK" name=3D"= nnn24" style=3D"display: inline-block !important; color: #00aeed !important= ; text-decoration: none !important;" class=3D"moreLink" data-cms-ai=3D"0">= <span class=3D"moreLink" style=3D"display: inl= ine-block; color: #00aeed; text-decoration: none; text-transform: uppercase= ;"> Read More </span> </a> </p> </td> </tr> </tbody> </table> </td> </tr> </tbody> </table> </td> </tr> <tr> <td height=3D"18"> </td> </tr> <tr> <td width=3D"100%" colspan=3D"3" style=3D"border-collapse: collapse; mso-table-lspace: 0pt; mso-tabl= e-rspace: 0pt;"> <table width=3D"100%" cellspacing=3D"0" cellpadding=3D"0"> <tbody> <tr> <td class=3D"mobileColToRow extra-padding" width=3D"300= " valign=3D"top" style=3D"padding-left: 0; width: 300px;"> <div class=3D"mobileThumbnail" style=3D"width: 300p= x; overflow: hidden;"> <a href=3D"https://click1.e.hw-commercialdesign.com/pqqrcjwvhqlbdlyjbytljbw= llwblqdyrghmhkgchmfclhv_nfytfwwkqpnqpjdtpytww.html" xt=3D"SPCLICK" name=3D"= nnn25" style=3D"color:#000 !important; text-decoration: none !important;"= data-cms-ai=3D"0"><img src=3D"https://cdnassets.hw.net/dims4/GG/a586800/21= 47483647/thumbnail/300x200%3E/quality/90/?url=3Dhttps%3A%2F%2Fcdnassets.hw.= net%2F44%2F8b%2Fc9a232a9469e95169e449044abca%2Faia-hero-2020-black-on-red.j= pg" width=3D"300" height=3D"200" border=3D"0" alt=3D"AIA to Assist US Congr= ess in Architect of the Capitol Search" data-size=3D"promo_300x200"></a>=20= </div> </td> <td style=3D"border-collapse: collapse; mso-table-lspac= e: 0pt; mso-table-rspace: 0pt;"> <table class=3D"img-spacer" width=3D"12" align=3D"c= enter" style=3D"width: 12px; height: 0;"> <tr> <td> </td> </tr> </table> </td> <td class=3D"mobileColToRow" width=3D"303" colspan=3D"1= " rowspan=3D"1" valign=3D"top" style=3D"clear: both; padding-left: 0; "> <table width=3D"100%"> <tbody> <tr> <td class=3D"eyebrow" style=3D"color:= #ed1f24; padding-bottom: 5px;"> <p style=3D"display: inline-block= !important; color: #ed1f24 !important; margin-top: 0; margin-bottom: 0 !im= portant; font-size: 0.7em; font-weight: bold; text-transform: uppercase;"> <span style=3D"display: inline-= block; color: #ed1f24;"> Press Release </span> </p> </td> </tr> <tr> <td style=3D"color: #000000 !important;= "> <h2 style=3D"display: inline-block= !important; color: #000000; margin-top: 0; margin-bottom: 0 !important;=20= font-size: 1.4em; font-weight: bold; line-height: 1.1em;"> <a href=3D"https://click1.e.hw-commercialdesign.com/uggzpwvchqfsmfgwsgbfwsv= ffvsfqmgzjhnhkjphnypfqy_nfytfwwkqpnqpjdtpytww.html" xt=3D"SPCLICK" name=3D"= nnn26" style=3D"color: #000000 !important; text-decoration: none !important= ;" data-cms-ai=3D"0"> <span= style=3D"color: #000000; text-decoration: none;"> AIA to Assist US Congre= ss in Architect of the Capitol Search </span> </a> </h2> </td> </tr> <tr> <td style=3D"color: #6c6c6c !important;= "> <p style=3D"margin-top: 0; margin-b= ottom: 0 !important; font-size: 0.9em; color: #6c6c6c !important; line-heig= ht: 1.5em;"> <span style=3D"color: #6c6c6c;"= > The American Institute of Arc= hitects aims to help the United States government "find the best candidate= who possesses the skills and attributes to… </span> <a href=3D"https://click1.e.hw-commercialdesign.com/pymrcjwvhqlbdlyjbytljbw= llwblqdyrghmhkgchmfclqh_nfytfwwkqpnqpjdtpytww.html" xt=3D"SPCLICK" name=3D"= nnn27" style=3D"display: inline-block !important; color: #00aeed !important= ; text-decoration: none !important;" class=3D"moreLink" data-cms-ai=3D"0">= <span class=3D"moreLink" style=3D"display: inl= ine-block; color: #00aeed; text-decoration: none; text-transform: uppercase= ;"> Read More </span> </a> </p> </td> </tr> </tbody> </table> </td> </tr> </tbody> </table> </td> </tr> <tr> <td height=3D"18"> </td> </tr> <tr> <td width=3D"100%" colspan=3D"3" style=3D"border-collapse: collapse; mso-table-lspace: 0pt; mso-tabl= e-rspace: 0pt;"> <table width=3D"100%" cellspacing=3D"0" cellpadding=3D"0"> <tbody> <tr> <td class=3D"mobileColToRow extra-padding" width=3D"300= " valign=3D"top" style=3D"padding-left: 0; width: 300px;"> <div class=3D"mobileThumbnail" style=3D"width: 300p= x; overflow: hidden;"> <a href=3D"https://click1.e.hw-commercialdesign.com/ugfzpwvchqfsmfgwsgbfwsv= ffvsfqmgzjhnhkjphnypfqq_nfytfwwkqpnqpjdtpytww.html" xt=3D"SPCLICK" name=3D"= nnn28" style=3D"color:#000 !important; text-decoration: none !important;"= data-cms-ai=3D"0"><img src=3D"https://cdnassets.hw.net/dims4/GG/b6d356a/21= 47483647/thumbnail/300x200%3E/quality/90/?url=3Dhttps%3A%2F%2Fcdnassets.hw.= net%2F0c%2F21%2F0696782742839ad12e32b35e6b3d%2Funtitled-1.jpg" width=3D"300= " height=3D"200" border=3D"0" alt=3D"Golden Lion and Silver Lion Awards Ann= ounced at the 2023 Venice Biennale" data-size=3D"promo_300x200"></a> =20= </div> </td> <td style=3D"border-collapse: collapse; mso-table-lspac= e: 0pt; mso-table-rspace: 0pt;"> <table class=3D"img-spacer" width=3D"12" align=3D"c= enter" style=3D"width: 12px; height: 0;"> <tr> <td> </td> </tr> </table> </td> <td class=3D"mobileColToRow" width=3D"303" colspan=3D"1= " rowspan=3D"1" valign=3D"top" style=3D"clear: both; padding-left: 0; "> <table width=3D"100%"> <tbody> <tr> <td class=3D"eyebrow" style=3D"color:= #ed1f24; padding-bottom: 5px;"> <p style=3D"display: inline-block= !important; color: #ed1f24 !important; margin-top: 0; margin-bottom: 0 !im= portant; font-size: 0.7em; font-weight: bold; text-transform: uppercase;"> <span style=3D"display: inline-= block; color: #ed1f24;"> Press Release </span> </p> </td> </tr> <tr> <td style=3D"color: #000000 !important;= "> <h2 style=3D"display: inline-block= !important; color: #000000; margin-top: 0; margin-bottom: 0 !important;=20= font-size: 1.4em; font-weight: bold; line-height: 1.1em;"> <a href=3D"https://click1.e.hw-commercialdesign.com/zbwgwpvfrmlkdlbpkbjlpkv= llvklmdbgcrsrqcwrszwlmp_nfytfwwkqpnqpjdtpytww.html" xt=3D"SPCLICK" name=3D"= nnn29" style=3D"color: #000000 !important; text-decoration: none !important= ;" data-cms-ai=3D"0"> <span= style=3D"color: #000000; text-decoration: none;"> Golden Lion and Silver= Lion Awards Announced at the 2023 Venice Biennale </span> </a> </h2> </td> </tr> <tr> <td style=3D"color: #6c6c6c !important;= "> <p style=3D"margin-top: 0; margin-b= ottom: 0 !important; font-size: 0.9em; color: #6c6c6c !important; line-heig= ht: 1.5em;"> <span style=3D"color: #6c6c6c;"= > Top honors were given to fou= r recipients during the international architecture event's 18th edition on= May 20 in Venice, Italy. </span> <a href=3D"https://click1.e.hw-commercialdesign.com/tbjdmhsplzckjcbhkbfchks= ccskczjbdtlvlrtmlvwmczb_nfytfwwkqpnqpjdtpytww.html" xt=3D"SPCLICK" name=3D"= nnn30" style=3D"display: inline-block !important; color: #00aeed !important= ; text-decoration: none !important;" class=3D"moreLink" data-cms-ai=3D"0">= <span class=3D"moreLink" style=3D"display: inl= ine-block; color: #00aeed; text-decoration: none; text-transform: uppercase= ;"> Read More </span> </a> </p> </td> </tr> </tbody> </table> </td> </tr> </tbody> </table> </td> </tr> <tr> <td height=3D"18"> </td> </tr> <tr> <td width=3D"100%" colspan=3D"3" style=3D"border-collapse: collapse; mso-table-lspace: 0pt; mso-tabl= e-rspace: 0pt;"> <table width=3D"100%" cellspacing=3D"0" cellpadding=3D"0"> <tbody> <tr> <td class=3D"mobileColToRow extra-padding" width=3D"300= " valign=3D"top" style=3D"padding-left: 0; width: 300px;"> <div class=3D"mobileThumbnail" style=3D"width: 300p= x; overflow: hidden;"> <a href=3D"https://click1.e.hw-commercialdesign.com/xpcnjhkcdvbtsbphtplbhtk= bbktbvspnydrdqyjdrgjbvr_nfytfwwkqpnqpjdtpytww.html" xt=3D"SPCLICK" name=3D"= nnn31" style=3D"color:#000 !important; text-decoration: none !important;"= data-cms-ai=3D"0"><img src=3D"https://cdnassets.hw.net/dims4/GG/1ea9833/21= 47483647/thumbnail/300x200%3E/quality/90/?url=3Dhttps%3A%2F%2Fcdnassets.hw.= net%2Fd0%2F0a%2F0d5e98e44c5c9a01a6df64e158ed%2Fimg-2296-hero.jpg" width=3D"= 300" height=3D"200" border=3D"0" alt=3D"Postcard From Venice: Politics and= Decarbonization Loom Large" data-size=3D"promo_300x200"></a> =20= </div> </td> <td style=3D"border-collapse: collapse; mso-table-lspac= e: 0pt; mso-table-rspace: 0pt;"> <table class=3D"img-spacer" width=3D"12" align=3D"c= enter" style=3D"width: 12px; height: 0;"> <tr> <td> </td> </tr> </table> </td> <td class=3D"mobileColToRow" width=3D"303" colspan=3D"1= " rowspan=3D"1" valign=3D"top" style=3D"clear: both; padding-left: 0; "> <table width=3D"100%"> <tbody> <tr> <td class=3D"eyebrow" style=3D"color:= #ed1f24; padding-bottom: 5px;"> <p style=3D"display: inline-block= !important; color: #ed1f24 !important; margin-top: 0; margin-bottom: 0 !im= portant; font-size: 0.7em; font-weight: bold; text-transform: uppercase;"> <span style=3D"display: inline-= block; color: #ed1f24;"> VENICE BIENNALE </span> </p> </td> </tr> <tr> <td style=3D"color: #000000 !important;= "> <h2 style=3D"display: inline-block= !important; color: #000000; margin-top: 0; margin-bottom: 0 !important;=20= font-size: 1.4em; font-weight: bold; line-height: 1.1em;"> <a href=3D"https://click1.e.hw-commercialdesign.com/unyzpwvchqfsmfgwsgbfwsv= ffvsfqmgzjhnhkjphnypfqf_nfytfwwkqpnqpjdtpytww.html" xt=3D"SPCLICK" name=3D"= nnn32" style=3D"color: #000000 !important; text-decoration: none !important= ;" data-cms-ai=3D"0"> <span= style=3D"color: #000000; text-decoration: none;"> Postcard From Venice:= Politics and Decarbonization Loom Large </span> </a> </h2> </td> </tr> <tr> <td style=3D"color: #6c6c6c !important;= "> <p style=3D"margin-top: 0; margin-b= ottom: 0 !important; font-size: 0.9em; color: #6c6c6c !important; line-heig= ht: 1.5em;"> <span style=3D"color: #6c6c6c;"= > Ian Volner tours us through= day two of the 2023 Venice Biennale, which included a visit to the Ukraini= an Pavilion and with the 2023 Golden Lion… </span> <a href=3D"https://click1.e.hw-commercialdesign.com/ahmvtdrlmkpnspydnyzpdnr= pprnpksyvcmhmgctmhbtpkt_nfytfwwkqpnqpjdtpytww.html" xt=3D"SPCLICK" name=3D"= nnn33" style=3D"display: inline-block !important; color: #00aeed !important= ; text-decoration: none !important;" class=3D"moreLink" data-cms-ai=3D"0">= <span class=3D"moreLink" style=3D"display: inl= ine-block; color: #00aeed; text-decoration: none; text-transform: uppercase= ;"> Read More </span> </a> </p> </td> </tr> </tbody> </table> </td> </tr> </tbody> </table> </td> </tr> <tr> <td height=3D"18"> </td> </tr> <tr> <td width=3D"100%" colspan=3D"3" style=3D"border-collapse: collapse; mso-table-lspace: 0pt; mso-tabl= e-rspace: 0pt;"> <table width=3D"100%" cellspacing=3D"0" cellpadding=3D"0"> <tbody> <tr> <td class=3D"mobileColToRow extra-padding" width=3D"300= " valign=3D"top" style=3D"padding-left: 0; width: 300px;"> <div class=3D"mobileThumbnail" style=3D"width: 300p= x; overflow: hidden;"> <a href=3D"https://click1.e.hw-commercialdesign.com/imhtnvpcyhdwzdbvwbkdvwp= ddpwdhzbtrymyqrnymgndhz_nfytfwwkqpnqpjdtpytww.html" xt=3D"SPCLICK" name=3D"= nnn34" style=3D"color:#000 !important; text-decoration: none !important;"= data-cms-ai=3D"0"><img src=3D"https://cdnassets.hw.net/dims4/GG/7d35eec/21= 47483647/thumbnail/300x200%3E/quality/90/?url=3Dhttps%3A%2F%2Fcdnassets.hw.= net%2Fc8%2F43%2F17a9472746eaade0a8795b8ef532%2Fexh-columb-estebanmaria-hero= =2Ejpg" width=3D"300" height=3D"200" border=3D"0" alt=3D"Exhibit Columbus= Announces 2023 Opening-Weekend Schedule" data-size=3D"promo_300x200"></a>= </div> </td> <td style=3D"border-collapse: collapse; mso-table-lspac= e: 0pt; mso-table-rspace: 0pt;"> <table class=3D"img-spacer" width=3D"12" align=3D"c= enter" style=3D"width: 12px; height: 0;"> <tr> <td> </td> </tr> </table> </td> <td class=3D"mobileColToRow" width=3D"303" colspan=3D"1= " rowspan=3D"1" valign=3D"top" style=3D"clear: both; padding-left: 0; "> <table width=3D"100%"> <tbody> <tr> <td class=3D"eyebrow" style=3D"color:= #ed1f24; padding-bottom: 5px;"> <p style=3D"display: inline-block= !important; color: #ed1f24 !important; margin-top: 0; margin-bottom: 0 !im= portant; font-size: 0.7em; font-weight: bold; text-transform: uppercase;"> <span style=3D"display: inline-= block; color: #ed1f24;"> Press Release </span> </p> </td> </tr> <tr> <td style=3D"color: #000000 !important;= "> <h2 style=3D"display: inline-block= !important; color: #000000; margin-top: 0; margin-bottom: 0 !important;=20= font-size: 1.4em; font-weight: bold; line-height: 1.1em;"> <a href=3D"https://click1.e.hw-commercialdesign.com/wgvtnvkjdlsbzswvbwqsvbk= sskbslzwthdgdmhndgfnslj_nfytfwwkqpnqpjdtpytww.html" xt=3D"SPCLICK" name=3D"= nnn35" style=3D"color: #000000 !important; text-decoration: none !important= ;" data-cms-ai=3D"0"> <span= style=3D"color: #000000; text-decoration: none;"> Exhibit Columbus Announ= ces 2023 Opening-Weekend Schedule </span> </a> </h2> </td> </tr> <tr> <td style=3D"color: #6c6c6c !important;= "> <p style=3D"margin-top: 0; margin-b= ottom: 0 !important; font-size: 0.9em; color: #6c6c6c !important; line-heig= ht: 1.5em;"> <span style=3D"color: #6c6c6c;"= > The program's fourth exhibit= ion kicks off on Aug. 25. </span> <a href=3D"https://click1.e.hw-commercialdesign.com/tmvdmhsplzckjcbhkbfchks= ccskczjbdtlvlrtmlvwmchw_nfytfwwkqpnqpjdtpytww.html" xt=3D"SPCLICK" name=3D"= nnn36" style=3D"display: inline-block !important; color: #00aeed !important= ; text-decoration: none !important;" class=3D"moreLink" data-cms-ai=3D"0">= <span class=3D"moreLink" style=3D"display: inl= ine-block; color: #00aeed; text-decoration: none; text-transform: uppercase= ;"> Read More </span> </a> </p> </td> </tr> </tbody> </table> </td> </tr> </tbody> </table> </td> </tr> <tr> <td height=3D"18"> </td> </tr> =09=09=09=09=09=09=09 <tr> <td width=3D"600" valign=3D"top" align=3D"center" style=3D"padding-bottom: 20px; border-bottom: 3px solid #000;"></td= > </tr> <tr> <td height=3D"10"> </td> </tr><tr> <td style=3D"color: #000000 !important;"><h2 style=3D"displ= ay: inline-block !important; color: #000000; margin-top: 0; margin-bottom:= 0 !important; font-size: 1.0em; font-weight: bold; line-height: 1.1em;">= <span style=3D"color: #ed1f24; text-decoration: none;"> Upcoming Events:= </span></h2></td> </tr> <tr> <td height=3D"10"> </td> </tr> <tr> <td style=3D"color: #000000 !important;= "> <h2 style=3D"display: inline-block= !important; color: #000000; margin-top: 0; margin-bottom: 0 !important;=20= font-size: .9em; font-weight: bold; line-height: 1.1em;"> <a href=3D"https://click1.e.hw-commercialdesign.com/fgncghtydsnwrnbhwbznhwt= nntwnsrbcpdjdlpgdjqgnhd_nfytfwwkqpnqpjdtpytww.html" name=3D"nnn50" style=3D= "color: #000000 !important; text-decoration: none !important;" data-cms-ai= =3D"0"> <span style=3D"color= : #000000; text-decoration: none;"> Architect Connections</a= > — Jun 5-6, 2023 | Beacon Grand, San Francisco, CA=20 </span> </a> </h2> </td> </tr> <tr> <td style=3D"color: #6c6c6c !important;= "> <p style=3D"margin-top: 0; margin-b= ottom: 0 !important; font-size: 0.8em; color: #6c6c6c !important; line-heig= ht: 1.5em;"> <span style=3D"color: #6c6c6c;"= > <b>Grow Your Network at Archi= tect Connections</b><br/>Get matched through double opt-in meetings this=20= June. Find your next partner, client, supplier, or solution provider. YOU= set the agenda, ask the questions… </span> <h2 style=3D"display:= inline-block !important; color: #000000; margin-top: 0; margin-bottom: 0= !important; font-size: 0.8em; font-weight: bold; line-height: 1.1em;"><a= href=3D"https://click1.e.hw-commercialdesign.com/fggcghtydsnwrnbhwbznhwtnn= twnsrbcpdjdlpgdjqgnhs_nfytfwwkqpnqpjdtpytww.html" name=3D"nnn51" style=3D"c= olor: #000000 !important; text-decoration: none !important;" data-cms-ai=3D= "0"> <span class=3D"moreLink= " style=3D"display: inl= ine-block; color: #00aeed; text-decoration: none; text-transform: uppercase= ;">Register Now</span> </a></h2></td> </tr> =20 =20 =09=09=09=09=09=09 =09=09=09=09=09=09 =09=09=09=09=09 =20 =09=09=09=09=09=09=09 =09=09=09=09=09=09<tr> <td width=3D"600" valign=3D"top" align=3D"center" style=3D"padding-bottom: 20px; border-bottom: 3px solid #000;"></td= > </tr> </tr> =20 </tr> =20 =20 =09=09=09=09=09=09=09 =09=09=09=09=09 =20 =09=09=09=09=09 =20 =09=09=09=09=09=09=09 =09=09=09=09=09=09=09 </tr> =20 =20 =09=09=09=09=09=09=09 =09=09=09=09=09 =20 =09=09=09=09=09 =20 =09=09=09=09=09=09=09 =09=09=09=09=09=09=09 </tr> =20 <tr> <td class=3D"mobileSpecialLinks" width=3D"600" style=3D"padding-top:=20= 10px; padding-bottom: 20px;" valign=3D"top"> <span style=3D"margin-top: 0; margin-right: 0; margin-bottom: 0;=20= margin-left: 0; padding-top: 0; padding-right: 0; padding-bottom: 0; paddin= g-left: 0; list-style-type: none;"> =20 =20 <span class=3D"" style=3D"margin-left: 0;"> <a href=3D"https://click1.e.hw-commercialdesign.com/wnztnvkjdlsbzswvbwqsvbk= sskbslzwthdgdmhndgfnsvv_nfytfwwkqpnqpjdtpytww.html" name=3D"nnn56" style=3D= "color: #ed1f24 !important; text-decoration: none !important;" class=3D"sp= ecial-link" target=3D"_blank" data-cms-ai=3D"0"> <span= class=3D"special-link" style=3D"color: #ed1f24 !important; font-size:= 1.0em !important;"> Advertise </span> </a> <br /> <span class=3D"" style=3D"margin-left: 0;"> <a href=3D"https://click1.e.hw-commercialdesign.com/fgycghtydsnwrnbhwbznhwt= nntwnsrbcpdjdlpgdjqgnhb_nfytfwwkqpnqpjdtpytww.html" name=3D"nnn57" style=3D= "color: #ed1f24 !important; text-decoration: none !important;" class=3D"sp= ecial-link" target=3D"_blank" data-cms-ai=3D"0"> <span= class=3D"special-link" style=3D"color: #ed1f24 !important; font-size:= 1.0em !important;"> Contact Us </span> </a> =20 =20 </td> </tr> <tr> =20 <table align=3D"center" width=3D"100%" border=3D"0" cellspacing=3D"= 0" cellpadding=3D"0"> <tr> <td> <p style=3D"text-align: center; margin-top: 0; margin-b= ottom: 5px !important; font-size: 1.25em; font-weight: bold; font-style:=20= italic;"> Follow Us </p> </td> </tr> <tr> <td style=3D"text-align: center; padding-left: 5px; padding= -right: 5px;"> <span style=3D"display: inline-block;"> <a name=3D"" style=3D"text-decoration: none;"= href=3D"https://click1.e.hw-commercialdesign.com/cqhkjpvmtdlfqlgpfgrlpfvll= vfldqgkstctzsjtchjlpc_nfytfwwkqpnqpjdtpytww.html" data-cms-ai=3D"0"> <img src=3D"https://cdnassets.hw.net/91/86/377e5fc44ee487474f8ce468e54e/twi= tter-social-icon-circle-resize.png" width=3D"35" height=3D"35" border=3D"0"= > </a> </span> <span> </span> <span style=3D"display: inline-block;"> <a name=3D"" style=3D"text-decoration: none;"= href=3D"https://click1.e.hw-commercialdesign.com/msczbympcqdlsdtyltgdylmdd= mldqstzjcncvjbcnwbdyd_nfytfwwkqpnqpjdtpytww.html" data-cms-ai=3D"0"> <img src=3D"https://cdnassets.hw.net/51/b1/8422958f420fa89dec46e141ef33/fac= ebook-resize.png" width=3D"35" height=3D"35" border=3D"0"> =20= </a> </span> <span> </span> <span style=3D"display: inline-block;"> <a name=3D"" style=3D"text-decoration: none;"= href=3D"https://click1.e.hw-commercialdesign.com/slrzsvwpbrktlkcvtcfkvtwkk= wtkrlczgbmbhgsbmjskvs_nfytfwwkqpnqpjdtpytww.html" data-cms-ai=3D"0"> <img src=3D"https://cdnassets.hw.net/39/2f/1a3453ae432b833ad88dee73260d/lin= kedin-resize.png" width=3D"35" height=3D"35" border=3D"0"> =20= </a> </span> <span> </span> <span style=3D"display: inline-block;"> <a name=3D"" style=3D"text-decoration: none;"= href=3D"https://click1.e.hw-commercialdesign.com/zdpgwpvfrmlkdlbpkbjlpkvll= vklmdbgcrsrqcwrszwlpd_nfytfwwkqpnqpjdtpytww.html" data-cms-ai=3D"0"> <img src=3D"https://cdnassets.hw.net/dd/11/e9739a9547fca36c636a7fba9279/ins= tagram-resize.png" width=3D"35" height=3D"35" border=3D"0"> =20= </a> </span> <span> </span> <span style=3D"display: inline-block;"> <a name=3D"" style=3D"text-decoration: none;"= href=3D"https://click1.e.hw-commercialdesign.com/frbcghtydsnwrnbhwbznhwtnn= twnsrbcpdjdlpgdjqgnhy_nfytfwwkqpnqpjdtpytww.html" data-cms-ai=3D"0"> <img src=3D"https://cdnassets.hw.net/f3/05/5205782847ab99e767d07c999f52/pin= terest-resize.png" width=3D"35" height=3D"35" border=3D"0"> =20= </a> </span> =20 </td> </tr> </table> </td> </tr> <tr> <td width=3D"600" style=3D"padding-top: 15px; text-align: center; clear= : both;"> =20 =20 <span style=3D"padding-bottom: 10px; font-family: Arial, Helvet= ica, sans-serif; font-size: 1.0em;"> <a href=3D"https://click1.e.hw-commercialdesign.com/oflcrjsqtzldmlkjdkgljds= llsdlzmkcptwtnprtwfrlkf_nfytfwwkqpnqpjdtpytww.html" name=3D"nnn64" style=3D= "text-decoration: underline !important; color: #00aeed !important;" target= =3D"_blank" data-cms-ai=3D"0">AIA</a> =20 </span> </td> </tr> <tr> <td style=3D"height: 5px; line-height: 0; overflow: hidden; clear: both= ;"> =20 </td> </tr> <tr> <td width=3D"615" style=3D"padding-top: 10px; padding-bottom: 10px; tex= t-align: center; clear: both;"> <p style=3D"margin-top: 0; margin-botto= m:10px; font-size: 0.6em; color: #777 !important;">=20 To make sure you continue to receive our e-mails in your inbox (not in your= bulk or junk folders), please add architectnewswire@e.hw-commercialdesign.= com to your address book or safe sender list. </p> =20 =20 <p style=3D"margin-top: 0; margin-bottom:10px;= font-size: 0.6em; color: #777 !important;"> <a href=3D"https://click1.e.hw-commercialdesign= =2Ecom/chjkjpvmtdlfqlgpfgrlpfvllvfldqgkstctzsjtchjlgt_nfytfwwkqpnqpjdtpytww= =2Ehtml?a=3Delvis%40ebaarchitects.org" style=3D"color:#00aeef !important;= text-decoration: none !important;" data-cms-ai=3D"0">Click Here</a> to uns= ubscribe from ARCHITECT Newswire.</p> <p style=3D"margin-top: 0; margin-bottom:10px; font-size: 0.6em; color: #77= 7 !important;"> =20 =20 =09=09 =20 =20 =09=09 <p style=3D"margin-top: 0; margin-bottom:0; font-= size: 0.6em; color: #777 !important;">=C2=A9 Zonda Media, a Delaware corpor= ation. All Rights Reserved. Republication or re-dissemination of this newsl= etter's content is expressly prohibited without the written permission of= <a href=3D"https://click1.e.hw-commercialdesign.com/absvtdrlmkpnspydnyzpdn= rpprnpksyvcmhmgctmhbtpyk_nfytfwwkqpnqpjdtpytww.html">Zonda Media, a Delawar= e corporation.</a> </p><p style=3D"margin-top: 0; margin-bottom:0; font-siz= e: 0.6em; color: #777 !important;"> Zonda Media, a Delaware corporation | 1152 15th St. NW | Suite 850 | Washin= gton, DC 20005-5811</p> =09=09=09=09=09=09=09 </td> </tr> </table> </td> </tr> </table> <style type=3D"text/css"> /* Forces Outlook.com to display emails at full width */ .ExternalClass, .ExternalClass p, .ExternalClass span, .ExternalClass= font, .ExternalClass td, .ExternalClass div { line-height: 100%; } .ReadMsgBody { width: 100%; } .ExternalClass { width: 100%; line-height: 100%; } .ExternalClass p { margin-bottom: 0 !important; } /* Override AOL defaults */ body {font-family:Helvetica, Arial, sans-serif;font-size:12pt;margin:= 0;} th {font-size:12pt;} td {color: #6c6c6c;} td.eyebrow p a= [href]= { color: #ed1f24 !important; } /*Yahoo adds span.yshortcuts inside all links*/ a:link, span.yshortcuts { color: #000; /* Link color must be set inline for Gmail*/ background-color: none; border: none; text-decoration: none; } /* Overrides Outlook.com Contextual Highlighting */ span { color: #6c6c6c; border-bottom-width: 0; border-bottom-style: none; } p a:link, p span.yshortcuts { text-decoration: underline; } p a:active, p a:visited, p span.yshortcuts:active { text-decoration: underline; } a:active, a:visited, span.yshortcuts:active { color: #000; background-color: none; border: none; text-decoration: none; } a:hover, span.yshortcuts:hover, span.yshortcuts:focus { text-decoration: underline; } a.special-link, span.special-link { color: #f01e27 !important; text-decoration: none !important; } a.moreLink, span.moreLink, p a= [href]= { color: #00aeed !important; text-decoration: none !important; } h1 { color: #00aeed !important; text-decoration: none !important; } h1, h2, h3, h4, h5, h6, p, span { font-family: Arial, Helvetica, sans-serif; } h2, h4, h5 { color: #000 !important; /* Override Hotmail and Yahoo head tag colo= rs - Must also be set inline */ } h3 { color: #fff !important; } h6 { color: #777 !important; } .quote { color: #00adef !important; } p { margin-bottom: 0 !important; } .footertext { color: #777 !important; } table { border-collapse: collapse; } .MsoNormal { padding-bottom: 0 } /* =3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D= =3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D= =3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D= =3D=3D Mobile =3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D= =3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D= =3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D= =3D=3D */ table= [class=3D"mobileWrapper"]= { width: 650px !important; } table= [class=3D"mobileContent"]= { width: 615px !important; background-color: #ffffff !important; } table= [class=3D"mobileContent"]= td= [class=3D"50-50"]= > table { /*width: 300px !important;*/ max-width: 100% !important; } /*table= [class=3D"mobileContent"]= td= [class=3D"50-50"]= table= [align=3D"left"]= td{ padding-right: 12px !important; }*/ table.mobileContent td.mobileLogo { display: block !important; } table.mobileContent tr.mobileMobileLogo { display: none !important; text-align: left; } table.mobileContent td.mobileSocial img { margin: 0 !important; } table.mobileContent td.mobileSocial td { display: inline-block !important; width: auto !important; } table.mobileContent td.mobileAdwrapper img { border-style: none !important; } table.mobileContent td.extra-padding { padding-top: 5px !important; padding-bottom: 5px !important; } table.mobileContent td.extra-padding-bottom{ padding-bottom:18px !important; } @media only screen and (max-width: 614px) { table= [class=3D"mobileWrapper"]= { display: block !important; width: 350px !important; height: auto !important; padding: 0 15px !important } table= [class=3D"mobileContent"]= , table= [class=3D"mobileContent"]= table, table= [class=3D"mobileContent"]= thead, table= [class=3D"mobileContent"]= tbody, table= [class=3D"mobileContent"]= tfoot, table= [class=3D"mobileContent"]= th, table= [class=3D"mobileContent"]= td, table= [class=3D"mobileContent"]= tr, table= [class=3D"mobileContent"]= div.mobileThumbnail { display: block !important; width: 100% !important; height: auto !important; } table= [class=3D"mobileContent"]= td= [class=3D"50-50"]= > table{ width: 100% !important; float: none !important; clear: both !important; margin: 0 auto !important; } table= [class=3D"mobileContent"]= table= [class=3D"img-spacer"]= { display: none !important; } table= [class=3D"mobileContent"]= td= [class=3D"50-50"]= > table= [class=3D"spacer"]= { width: 100% !important; height: 10px !important; } table= [class=3D"mobileContent"]= td= [class=3D"50-50"]= > table td= [class=3D"mobileAdwrapper"]= { text-align: center !important; } table= [class=3D"mobileContent"]= td= [class=3D"50-50"]= table= [align=3D"left"]= td{ padding-right: 0 !important; } table= [class=3D"mobileContent"]= h3 { min-height: 12px !important; height: auto !important; width: 100% !important; } table= [class=3D"mobileContent"]= .mobileLogo { height: auto; } table= [class=3D"mobileContent"]= td.mobileAdwrapper { padding-left: 0 !important; text-align: center !important; } table= [class=3D"mobileContent"]= div.mobileThumbnail { display: block !important; width: 300px !important; max-height: 200px !important; height: auto !important; overflow: hidden !important; margin: 0 auto; } table= [class=3D"mobileContent"]= div.mobileThumbnail img { width: 300px !important; height: auto !important; } table= [class=3D"mobileContent"]= .mobileLogoImg { width: 300px !important; height: auto !important; } table= [class=3D"mobileContent"]= .mobileLeaderboardAd { padding-left: 0 !important; padding-right: 0 !important; } table= [class=3D"mobileContent"]= .mobileLeaderboardAd div { width: 100% !important; } table= [class=3D"mobileContent"]= .mobileLeaderboardAd img { width: 100% !important; height: auto !important; } table= [class=3D"mobileContent"]= .colSeparator { display: none; } table= [class=3D"mobileContent"]= .mobileDate { border-top: none !important; height: 35px; } table= [class=3D"mobileContent"]= .mobileSpecialLinks td { padding-top: 0 !important; padding-bottom: 20px !important; } table= [class=3D"mobileContent"]= .mobileSpecialLinks ul { font-size: 0; text-align: center; } table= [class=3D"mobileContent"]= .mobileSpecialLinks li { /*padding-right: 25px;*/ font-size: 15px; display: inline-block; } table= [class=3D"mobileContent"]= .mobileSpecialLinks li.mobileFirstChild { /*padding-right: 0px;*/ float: left; } table= [class=3D"mobileContent"]= .mobileSpecialLinks li.mobileLastChild { /*padding-right: 0px;*/ float: right; } table= [class=3D"mobileContent"]= .mobileSpecialLinks li.mobileArrow { background-image: url('http://images.hanleywood.com/newsletters= /arrow-right.png'); width: 14px; height: 14px; float: left; margin-right: 2px; } table= [class=3D"mobileContent"]= .mobileSpecialLinks li.mobileArrow img { display: none; } table= [class=3D"mobileContent"]= .mobileMagazine { float: left; width: 145px; padding-right: 10px; border-bottom: none !important; } table= [class=3D"mobileContent"]= .mobileMagazine div { border-bottom: none !important; } table= [class=3D"mobileContent"]= .mobileMagImg, table= [class=3D"mobileContent"]= .mobileMagImg img { width: 145px !important; height: auto !important; } table= [class=3D"mobileContent"]= .mobilePublicationLinks { float: left; width: 145px; } table= [class=3D"mobileContent"]= .mobilePublicationLinks + tr { clear: both; } table= [class=3D"mobileContent"]= .mobileColToRow { margin-bottom: 10px; } table= [class=3D"mobileContent"]= .mobileSocialIcons { width: 100% border-top: 2px solid #000; height: 34px; padding: 2px 0 !important; } table= [class=3D"mobileContent"]= td.mobileSocial { padding-bottom: 5px; } /* mobile hacks for the current issue before footer */ table= [class=3D"mobileContent"]= tr.mobileMobileLogo td > div { width: 100% !important; overflow: auto !important; height: auto !important; line-height: normal !important; } table= [class=3D"mobileContent"]= tr.mobileMobileLogo { display: block !important; } table= [class=3D"mobileContent"]= tr.mobileMobileLogo td > div { display: block !important; height: auto !important; width: auto !important; } table= [class=3D"mobileContent"]= .utilityLinks a.special-link span.special-link { font-size: 0.6em !important; } table= [class=3D"mobileContent"]= td.mobileSocial img { display: inline-block !important; } table= [class=3D"mobileContent"]= td.extra-padding { padding-top: 0px !important; padding-bottom: 0px !important; } table= [class=3D"mobileContent"]= .zero-height { height: 0px !important; } table= [class=3D"mobileContent"]= div.mobileImage { width: 300px !important; overflow: hidden !important; height: 200px !important; } table= [class=3D"mobileContent"]= div.mobileImage img { width: 300px !important; height: auto !important; } table= [class=3D"mobileContent"]= span#mobileChart { display: block; width: 300px !important; height: 200px !important; } table= [class=3D"mobileContent"]= .colSeparator { display: none; } table= [class=3D"mobileContent"]= .mobileLeftCol { display: inline-block; } table= [class=3D"mobileContent"]= .mobileRightCol { width: 80px !important; float: right; } table= [class=3D"mobileContent"]= .mobileLogo td { display: table-cell; } table= [class=3D"mobileContent"]= .mobileHeader img { max-width: 300px; height: auto; } table= [class=3D"mobileContent"]= .mobileHeader, table= [class=3D"mobileContent"]= .mobileHeader table, table= [class=3D"mobileContent"]= .mobileHeader td { height: auto !important; } table= [class=3D"mobileContent"]= .mobileHeader table { margin-top: 5px !important; margin-bottom: 5px !important; } table= [class=3D"mobileContent"]= .mobileHeaderAd, table= [class=3D"mobileContent"]= .mobileHeaderAd table, table= [class=3D"mobileContent"]= .mobileHeaderAd tbody, table= [class=3D"mobileContent"]= .mobileHeaderAd td, table= [class=3D"mobileContent"]= .mobileHeaderAd tr, table= [class=3D"mobileContent"]= .mobileHeaderAd h6 { width: 80px !important; } table= [class=3D"mobileContent"]= .mobileHeaderAd h6 { font-size: .55em !important; -webkit-text-size-adjust: none; -moz-text-size-adjust: none; -ms-text-size-adjust: none; } table= [class=3D"mobileContent"]= .mobileHeaderAd { ] border: none !important; position: absolute; top: -40px; } table= [class=3D"mobileContent"]= .mobileHeaderAd img { max-width: 80px; height: auto; } table= [class=3D"mobileContent"]= .mobileFooterAd img { width: 300px !important; height: auto !important; } td= [id=3D"mobileHideMagazineIssue"]= { display: none !important;=20 } table= [id=3D"mobileRelative"]= { position: relative !important; top: 50px !important; } } </style> <img src=3D"https://00d819.efeedbacktrk.com/hnnlhbjfvqwzmwsbzsrwbzjwwjzwqms= ldvcvpdhvcnhcfn_nfytfwwkqpnqpjdtpytww.gif" width=3D"0" height=3D"0" alt=3D"= "> <span style=3D"display: none;"><a href=3D'https://click1.e.hw-commercial= design.com/vryqjpdyfvgnmgkpnkbgpndggdngvmkqcfhfzcjfhrjgkp_nfytfwwkqpnqpjdtp= ytww.html?a=3DA73B9126-8643-4D63-B66B-6284AE151CE7&b=3Dslvcvjjpbk'>Link</a>= </span> </body> </html>